Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9H9S5: Variant p.Tyr307Asn

Ribitol 5-phosphate transferase FKRP
Gene: FKRP
Feedback?
Variant information Variant position: help 307 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Tyrosine (Y) to Asparagine (N) at position 307 (Y307N, p.Tyr307Asn). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and aromatic (Y) to medium size and polar (N) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In MDDGC5 and MDDGA5; decrease in ribitol-5-phosphate transferase activity. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 307 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 495 The length of the canonical sequence.
Location on the sequence: help FGCNKETTRCFGTVVGDTPA Y LYEERWTPPCCLRALRETAR The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         FGCNKETTRCFGTVVGDTPAYLYEERWTPPCCLRALRETAR

Mouse                         FGCSKESARCFGTVAGDTPAYLYEGRWTPPCCLRALRETAR
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 495 Ribitol 5-phosphate transferase FKRP
Topological domain 30 – 495 Lumenal
Region 289 – 318 Zinc finger loop
Binding site 289 – 289
Binding site 296 – 296
Binding site 317 – 317
Binding site 318 – 318
Helix 306 – 309



Literature citations
Identification of a Post-translational Modification with Ribitol-Phosphate and Its Defect in Muscular Dystrophy.
Kanagawa M.; Kobayashi K.; Tajiri M.; Manya H.; Kuga A.; Yamaguchi Y.; Akasaka-Manya K.; Furukawa J.I.; Mizuno M.; Kawakami H.; Shinohara Y.; Wada Y.; Endo T.; Toda T.;
Cell Rep. 14:2209-2223(2016)
Cited for: FUNCTION; CATALYTIC ACTIVITY; PATHWAY; SUBCELLULAR LOCATION; MUTAGENESIS OF ASP-362; VARIANT ASN-307; Phenotypic spectrum associated with mutations in the fukutin-related protein gene.
Mercuri E.; Brockington M.; Straub V.; Quijano-Roy S.; Yuva Y.; Herrmann R.; Brown S.C.; Torelli S.; Dubowitz V.; Blake D.J.; Romero N.B.; Estournet B.; Sewry C.A.; Guicheney P.; Voit T.; Muntoni F.;
Ann. Neurol. 53:537-542(2003)
Cited for: VARIANTS MDDGB5 CYS-309; HIS-339 AND LEU-448; VARIANTS MDDGC5 ILE-276; ASN-307; SER-316; ASN-360 AND SER-462; Mutations in the FKRP gene can cause muscle-eye-brain disease and Walker-Warburg syndrome.
Beltran-Valero de Bernabe D.; Voit T.; Longman C.; Steinbrecher A.; Straub V.; Yuva Y.; Herrmann R.; Sperner J.; Korenke C.; Diesen C.; Dobyns W.B.; Brunner H.G.; van Bokhoven H.; Brockington M.; Muntoni F.;
J. Med. Genet. 41:E61-E61(2004)
Cited for: VARIANTS MDDGA5 ASN-307 AND TYR-318;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.