UniProtKB/Swiss-Prot Q14966: Variant p.Ala1912Val

Zinc finger protein 638
Gene: ZNF638
Feedback?

Variant information Variant position:

1912 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Alanine (A) to Valine (V) at position 1912 (A1912V, p.Ala1912Val). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from small size and hydrophobic (A) to medium size and hydrophobic (V) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs11542286 [ dbSNP | Ensembl ]

Sequence information Variant position:

1912 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

1978 The length of the canonical sequence.
Location on the sequence:

DSEPERKRKKTEDSSSGKSV A SDVPEELDFLVPKAGFFCPI The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         DSEPERKRKKTEDSSSGKSVASDVPEELDFLVPKAGFFCPI

Mouse                         DSEPDEKRRKTQDSSVGKSMTSDVPGDLDFLVPKAGFFCPI

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 1978	Zinc finger protein 638
Region	1867 – 1916	Disordered
Alternative sequence	815 – 1978	Missing. In isoform 2.
Alternative sequence	919 – 1978	Missing. In isoform 6.
Alternative sequence	1140 – 1978	Missing. In isoform 4.

Literature citations
Serological detection of cutaneous T-cell lymphoma-associated antigens.
Eichmueller S.; Usener D.; Dummer R.; Stein A.; Thiel D.; Schadendorf D.;
Proc. Natl. Acad. Sci. U.S.A. 98:629-634(2001)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5); IDENTIFICATION AS TUMOR-ASSOCIATED ANTIGEN; VARIANTS SER-980 AND VAL-1912;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.