Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9H0P0: Variant p.Leu181Pro

Cytosolic 5'-nucleotidase 3A
Gene: NT5C3A
Feedback?
Variant information Variant position: help 181 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Leucine (L) to Proline (P) at position 181 (L181P, p.Leu181Pro). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In P5ND; reduced catalytic activity in vitro; reduced protein stability in vivo, probably through increased proteasomal degradation. Any additional useful information about the variant.


Sequence information Variant position: help 181 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 336 The length of the canonical sequence.
Location on the sequence: help VQQALPKAKLKEIVAESDVM L KEGYENFFDKLQQHSIPVFI The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         VQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFI

Mouse                         IEQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFI

Chicken                       IEQGLQKDKLAEVVRESDVMLKEGYENFFDKLSEHNIPVFI
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 336 Cytosolic 5'-nucleotidase 3A



Literature citations
Functional analysis of pyrimidine 5'-nucleotidase mutants causing nonspherocytic hemolytic anemia.
Chiarelli L.R.; Bianchi P.; Fermo E.; Galizzi A.; Iadarola P.; Mattevi A.; Zanella A.; Valentini G.;
Blood 105:3340-3345(2005)
Cited for: CHARACTERIZATION OF P5ND VAL-137; PRO-181; SER-229 AND ARG-280; Molecular basis of Japanese variants of pyrimidine 5'-nucleotidase deficiency.
Kanno H.; Takizawa T.; Miwa S.; Fujii H.;
Br. J. Haematol. 126:265-271(2004)
Cited for: VARIANTS P5ND PRO-181 AND ARG-280; IDENTIFICATION OF ISOFORM 4; TISSUE SPECIFICITY; CHARACTERIZATION OF VARIANTS P5ND PRO-181 AND ARG-280; Molecular characterization of five Portuguese patients with pyrimidine 5'-nucleotidase deficient hemolytic anemia showing three new P5'N-I mutations.
Manco L.; Relvas L.; Silva Pinto C.; Pereira J.; Almeida A.B.; Ribeiro M.L.;
Haematologica 91:266-267(2006)
Cited for: VARIANTS P5ND PRO-181; ARG-207 AND THR-297;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.