UniProtKB/Swiss-Prot P11532 : Variant p.Asn1672Lys
Dystrophin
Gene: DMD
Feedback ?
Variant information
Variant position:
1672
The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:
LB/B
The variants are classified into three categories: LP/P, LB/B and US.LP/P: likely pathogenic or pathogenic. LB/B: likely benign or benign. US: uncertain significance
Residue change:
From Asparagine (N) to Lysine (K) at position 1672 (N1672K, p.Asn1672Lys).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:
Change from medium size and polar (N) to large size and basic (K)
The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:
0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another: Lowest score: -4 (low probability of substitution).Highest score: 11 (high probability of substitution). More information can be found on the following page
Other resources:
Links to websites of interest for the variant.
Sequence information
Variant position:
1672
The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:
3685
The length of the canonical sequence.
Location on the sequence:
KLSLLNSNWIAVTSRAEEWL
N LLLEYQKHMETFDQNVDHIT
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:
The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human KLSLLNSNWIAVTSRAEE----------------------WLN LLLEYQKHM----------------ETFDQNVDHIT
KLSLLNSNWIAVTSRAEE----------------------W
Mouse KLSLLNSNWIAVTSRVEE----------------------W
Rat KLTLLNSNWIAVTSRVEE----------------------W
Pig KLSLLNSNWIAVTSRAEE----------------------W
Chicken KLSLLNSNWIAVTSRAEE----------------------W
Caenorhabditis elegans KLRFLRADRDRLSSRTRKLAAKNPRLAATSSDVLAGLNQKW
Sequence annotation in neighborhood:
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:Type: the type of sequence feature. Positions: endpoints of the sequence feature. Description: contains additional information about the feature.
Type Positions Description
Chain
1 – 3685
Dystrophin
Repeat
1571 – 1676
Spectrin 12
Region
1415 – 1913
Interaction with SYNM
Alternative sequence
1 – 3068
Missing. In isoform 12, isoform 13, isoform 14, isoform 15, isoform 16 and isoform 17.
Alternative sequence
1 – 2729
Missing. In isoform 11.
Alternative sequence
1 – 2460
Missing. In isoform 6, isoform 7, isoform 8, isoform 9 and isoform 10.
Literature citations
Comprehensive mutation scanning of the dystrophin gene in patients with nonsyndromic X-linked dilated cardiomyopathy.
Feng J.; Yan J.Y.; Buzin C.H.; Sommer S.S.; Towbin J.A.;
J. Am. Coll. Cardiol. 40:1120-1124(2002)
Cited for: VARIANT LYS-1672;
Disclaimer:
Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.