Sequence information
Variant position: 1672 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: 3685 The length of the canonical sequence.
Location on the sequence:
KLSLLNSNWIAVTSRAEEWL
N LLLEYQKHMETFDQNVDHIT
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human KLSLLNSNWIAVTSRA----------------------EEWLN LLLEYQKHM----------------ETFDQNVDHIT
KLSLLNSNWIAVTSRA----------------------EEW
Mouse KLSLLNSNWIAVTSRV----------------------EEW
Rat KLTLLNSNWIAVTSRV----------------------EEW
Pig KLSLLNSNWIAVTSRA----------------------EEW
Chicken KLSLLNSNWIAVTSRA----------------------EEW
Caenorhabditis elegans KLRFLRADRDRLSSRTRKLAAKNPRLAATSSDVLAGLNQKW
Sequence annotation in neighborhood: The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:Type: the type of sequence feature. Positions: endpoints of the sequence feature. Description: contains additional information about the feature.
Type Positions Description
Chain
1 – 3685
Dystrophin
Repeat
1571 – 1676
Spectrin 12
Region
1415 – 1913
Interaction with SYNM
Alternative sequence
1 – 3068
Missing. In isoform 12, isoform 13, isoform 14, isoform 15, isoform 16 and isoform 17.
Alternative sequence
1 – 2729
Missing. In isoform 11.
Alternative sequence
1 – 2460
Missing. In isoform 6, isoform 7, isoform 8, isoform 9 and isoform 10.
Literature citations
Comprehensive mutation scanning of the dystrophin gene in patients with nonsyndromic X-linked dilated cardiomyopathy.
Feng J.; Yan J.Y.; Buzin C.H.; Sommer S.S.; Towbin J.A.;
J. Am. Coll. Cardiol. 40:1120-1124(2002)
Cited for: VARIANT LYS-1672;
Disclaimer:
Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.