Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9UEF7: Variant p.Phe352Val

Klotho
Gene: KL
Feedback?
Variant information Variant position: help 352 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Phenylalanine (F) to Valine (V) at position 352 (F352V, p.Phe352Val). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and aromatic (F) to medium size and hydrophobic (V) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Polymorphism: help Homozygosity for KL-VS allele is associated with decreased longevity and increased cardiovascular disease risk. Additional information on the polymorphism described.
Variant description: help In allele KL-VS. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 352 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1012 The length of the canonical sequence.
Location on the sequence: help FIDGDYPESMKNNLSSILPD F TESEKKFIKGTADFFALCFG The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         FIDGDYPESMKNNLSSILPDFTESEKKFIKGTADFFALCFG

Mouse                         FIDGDYPESMKNNLSSLLPDFTESEKRLIRGTADFFALSFG

Rat                           FIDGDYPKSMKNNLSSLLPDFTESEKRFIRGTADFFALSFG

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 34 – 1012 Klotho
Topological domain 34 – 981 Extracellular
Region 57 – 506 Glycosyl hydrolase-1 1
Glycosylation 344 – 344 N-linked (GlcNAc...) asparagine



Literature citations
Association of human aging with a functional variant of klotho.
Arking D.E.; Krebsova A.; Macek M. Sr.; Macek M. Jr.; Arking A.; Mian I.S.; Fried L.; Hamosh A.; Dey S.; McIntosh I.; Dietz H.C.;
Proc. Natl. Acad. Sci. U.S.A. 99:856-861(2002)
Cited for: VARIANTS KL-VS VAL-352 AND SER-370;
Association between a functional variant of the KLOTHO gene and high-density lipoprotein cholesterol, blood pressure, stroke, and longevity.
Arking D.E.; Atzmon G.; Arking A.; Barzilai N.; Dietz H.C.;
Circ. Res. 96:412-418(2005)
Cited for: VARIANTS KL-VS VAL-352 AND SER-370;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.