Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9HC29: Variant p.Asp382Glu

Nucleotide-binding oligomerization domain-containing protein 2
Gene: NOD2
Feedback?
Variant information Variant position: help 382 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Aspartate (D) to Glutamate (E) at position 382 (D382E, p.Asp382Glu). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and acidic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In BLAUS; hyperactive. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 382 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1040 The length of the canonical sequence.
Location on the sequence: help DIFQLLLDHPDRVLLTFDGF D EFKFRFTDRERHCSPTDPTS The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         DIFQLLLDHPDRVLLTFDGFDEFKFRFTDRERHCSPTDPTS

Chimpanzee                    DIFQLLLDHPDRVLLTFDGFDEFKFRFTDRERHCSPTDPTS

Mouse                         DVFQFLLDHPDRVLLTFDGLDEFKFRFTDRERHCSPIDPTS

Bovine                        DVFQVLLDHPERILLTFDGFDEFRFRFTDQERHCCPTAPTS

Rabbit                        DVFQFLLDHPDRILLTFDGFDEFKFKFTDHERHCSPTDPTS
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 1040 Nucleotide-binding oligomerization domain-containing protein 2
Domain 293 – 618 NACHT
Lipidation 395 – 395 S-palmitoyl cysteine
Alternative sequence 225 – 1040 Missing. In isoform 3.
Mutagenesis 379 – 379 D -> A. No disruption in NOD2-CARD9 interaction. Decreased NF-kappa-B activation in response to muramyl dipeptide stimulation.
Mutagenesis 395 – 395 C -> S. Abolished palmitoylation and localization to the cell membrane; when associated with S-1033.
Mutagenesis 396 – 396 S -> Y. Abolished NF-kappa-B activation in response to muramyl dipeptide stimulation.
Mutagenesis 401 – 401 T -> IS. Abolished NF-kappa-B activation in response to muramyl dipeptide stimulation.



Literature citations
Early-onset sarcoidosis and CARD15 mutations with constitutive nuclear factor-kappaB activation: common genetic etiology with Blau syndrome.
Kanazawa N.; Okafuji I.; Kambe N.; Nishikomori R.; Nakata-Hizume M.; Nagai S.; Fuji A.; Yuasa T.; Manki A.; Sakurai Y.; Nakajima M.; Kobayashi H.; Fujiwara I.; Tsutsumi H.; Utani A.; Nishigori C.; Heike T.; Nakahata T.; Miyachi Y.;
Blood 105:1195-1197(2005)
Cited for: VARIANTS BLAUS TRP-334; GLU-382; LEU-496; THR-513; PRO-605; THR-612 AND LYS-670; CHARACTERIZATION OF VARIANTS BLAUS GLU-382; LEU-496; THR-513; PRO-605 AND LYS-670; Role of the NOD2 genotype in the clinical phenotype of Blau syndrome and early-onset sarcoidosis.
Okafuji I.; Nishikomori R.; Kanazawa N.; Kambe N.; Fujisawa A.; Yamazaki S.; Saito M.; Yoshioka T.; Kawai T.; Sakai H.; Tanizaki H.; Heike T.; Miyachi Y.; Nakahata T.;
Arthritis Rheum. 60:242-250(2009)
Cited for: VARIANTS BLAUS GLN-334; TRP-334; GLU-382; GLY-383; TYR-495; LEU-496; THR-513; PRO-605 AND LYS-670;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.