Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P02458: Variant p.Gly1305Asp

Collagen alpha-1(II) chain
Gene: COL2A1
Feedback?
Variant information Variant position: help 1305 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Glycine (G) to Aspartate (D) at position 1305 (G1305D, p.Gly1305Asp). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from glycine (G) to medium size and acidic (D) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In VPED. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 1305 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1487 The length of the canonical sequence.
Location on the sequence: help DLKLCHPEWKSGDYWIDPNQ G CTLDAMKVFCNMETGETCVY The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         DLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVY

Mouse                         DLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVY

Rat                           DLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGESCVY

Bovine                        DLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVY

Xenopus laevis                DLKLCHPEWKSGDYWIDPNQGCTVDAIKVFCDMETGETCVY

Xenopus tropicalis            DLKLCHPEWKSGDYWIDPNQGCTVDAIKVFCNMETGETCVY
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1242 – 1487 Chondrocalcin
Domain 1253 – 1487 Fibrillar collagen NC1
Binding site 1301 – 1301
Binding site 1303 – 1303
Binding site 1304 – 1304
Binding site 1306 – 1306
Binding site 1309 – 1309
Disulfide bond 1283 – 1315
Disulfide bond 1289 – 1289 Interchain (with C-1306)
Disulfide bond 1306 – 1306 Interchain (with C-1289)



Literature citations
Vitreoretinopathy with phalangeal epiphyseal dysplasia, a type II collagenopathy resulting from a novel mutation in the C-propeptide region of the molecule.
Richards A.J.; Morgan J.; Bearcroft P.W.P.; Pickering E.; Owen M.J.; Holmans P.; Williams N.; Tysoe C.; Pope F.M.; Snead M.P.; Hughes H.;
J. Med. Genet. 39:661-665(2002)
Cited for: VARIANT VPED ASP-1305;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.