Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q13402: Variant p.Thr165Met

Unconventional myosin-VIIa
Gene: MYO7A
Feedback?
Variant information Variant position: help 165 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Threonine (T) to Methionine (M) at position 165 (T165M, p.Thr165Met). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (T) to medium size and hydrophobic (M) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In USH1B. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 165 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 2215 The length of the canonical sequence.
Location on the sequence: help MKRNSRDQCCIISGESGAGK T ESTKLILQFLAAISGQHSWI The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         MKRNSRDQCCIISGESGAGKTESTKLILQFLAAISGQHSWI

Mouse                         MKRNNRDQCCIISGESGAGKTESTKLILQFLAAISGQHSWI

Drosophila                    MKRYRQDQCIVISGESGAGKTESTKLILQYLAAISGKHSWI

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 2215 Unconventional myosin-VIIa
Domain 65 – 741 Myosin motor
Binding site 158 – 165



Literature citations
Characterization of Usher syndrome type I gene mutations in an Usher syndrome patient population.
Ouyang X.M.; Yan D.; Du L.L.; Hejtmancik J.F.; Jacobson S.G.; Nance W.E.; Li A.R.; Angeli S.; Kaiser M.; Newton V.; Brown S.D.M.; Balkany T.; Liu X.Z.;
Hum. Genet. 116:292-299(2005)
Cited for: VARIANTS USH1B ARG-25; MET-165; TRP-756; ASP-968 AND GLN-1883; VARIANT SER-16;
Survey of the frequency of USH1 gene mutations in a cohort of Usher patients shows the importance of cadherin 23 and protocadherin 15 genes and establishes a detection rate of above 90%.
Roux A.-F.; Faugere V.; Le Guedard S.; Pallares-Ruiz N.; Vielle A.; Chambert S.; Marlin S.; Hamel C.; Gilbert B.; Malcolm S.; Claustres M.;
J. Med. Genet. 43:763-768(2006)
Cited for: VARIANTS USH1B ASP-133; ARG-163; ARG-164; MET-165; THR-198; ALA-204; ASP-519; LYS-1170; GLN-1240; PRO-1858; TRP-1873 AND PHE-1962 DEL; VARIANTS MET-1566 AND CYS-1719;
Novel and recurrent MYO7A mutations in Usher syndrome type 1 and type 2.
Rong W.; Chen X.; Zhao K.; Liu Y.; Liu X.; Ha S.; Liu W.; Kang X.; Sheng X.; Zhao C.;
PLoS ONE 9:E97808-E97808(2014)
Cited for: VARIANTS USH1B MET-165 AND ARG-946;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.