Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot O15205: Variant p.Ile68Thr

Ubiquitin D
Gene: UBD
Feedback?
Variant information Variant position: help 68
Type of variant: help LB/B
Residue change: help From Isoleucine (I) to Threonine (T) at position 68 (I68T, p.Ile68Thr).
Physico-chemical properties: help Change from medium size and hydrophobic (I) to medium size and polar (T)
BLOSUM score: help -1
Other resources: help


Sequence information Variant position: help 68
Protein sequence length: help 165
Location on the sequence: help QVLLLGSKILKPRRSLSSYG I DKEKTIHLTLKVVKPSDEEL
Residue conservation: help
Human                         QVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEEL

Mouse                         QILLLDSKILKPHRKLSSYGIDKETTIHLTLKVVKPSDEEL

Rat                           QILLLDSKILKPHRALSSYGIDKENTIHLTLKVVKPSDEEL

Sequence annotation in neighborhood: help
TypePositionsDescription
Chain 1 – 165 Ubiquitin D
Domain 6 – 81 Ubiquitin-like 1
Mutagenesis 75 – 75 H -> D. Decreases interaction with MAD2L1, no effect on the interaction with HDAC6, UBA6, NUB1 and SQSTM1 and moderately attenuates UBD-induced tumor formation in vivo; when associated with D-77 and Q-79. Complete loss of interaction with MAD2L1, no effect on the interaction with TP53/p53, HDAC6, UBA6, NUB1 and SQSTM1 and significantly attenuates UBD-induced tumor formation in vivo; when associated with D-11; Q-13; D-77 and Q-79.
Mutagenesis 77 – 77 T -> D. Decreases interaction with MAD2L1, no effect on the interaction with HDAC6, UBA6, NUB1 and SQSTM1 and moderately attenuates UBD-induced tumor formation in vivo; when associated with D-75 and Q-79. Complete loss of interaction with MAD2L1, no effect on the interaction with TP53/p53, HDAC6, UBA6, NUB1 and SQSTM1 and significantly attenuates UBD-induced tumor formation in vivo; when associated with D-11; Q-13; D-75 and Q-79.
Mutagenesis 79 – 79 K -> Q. Decreases interaction with MAD2L1, no effect on the interaction with HDAC6, UBA6, NUB1 and SQSTM1 and moderately attenuates UBD-induced tumor formation in vivo; when associated with D-75 and D-77. Complete loss of interaction with MAD2L1, no effect on the interaction with TP53/p53, HDAC6, UBA6, NUB1 and SQSTM1 and significantly attenuates UBD-induced tumor formation in vivo; when associated with D-11; Q-13; D-75 and D-77.



Literature citations
No reference for the current variant in UniProtKB/Swiss-Prot.
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.