Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P51993: Variant p.Pro124Ser

4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT6
Gene: FUT6
Feedback?
Variant information Variant position: help 124 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Proline (P) to Serine (S) at position 124 (P124S, p.Pro124Ser). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and hydrophobic (P) to small size and polar (S) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Polymorphism: help Expression of alpha(1,3)-fucosyltransferase in plasma can vary among different populations. 9% of individuals on the isle of Java (Indonesia) do not express this enzyme. Ninety-five percent of plasma alpha(1,3)-fucosyltransferase-deficient individuals have Lewis negative phenotype on red cells, suggesting strong linkage disequilibrium between these two traits. Variations in FUT6 are responsible for plasma alpha(1,3)-fucosyltransferase deficiency [MIM:613852]. Additional information on the polymorphism described.
Variant description: help Found in individuals with plasma alpha(1,3)-fucosyltransferase deficiency and no clinically relevant phenotype; results in partial enzyme inactivation; complete enzyme inactivation when associated with V-244 and G-303. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 124 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 359 The length of the canonical sequence.
Location on the sequence: help AVIVHHREVMYNPSAQLPRS P RRQGQRWIWFSMESPSHCWQ The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         AVIVHHREVMYNPSAQLPRSPRRQGQRWIWFSMESPSHCWQ

Gorilla                       AVIVHHREVMYNPSAQLPRSPRRQGQRWIWFSMESPSHCWQ

Chimpanzee                    AVIVHHREVMYNPSAQLPRSPRRQGQRWIWFSMESPSNCRH

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 359 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT6
Topological domain 35 – 359 Lumenal
Mutagenesis 110 – 110 R -> W. Reduces dramatically alpha(1,3)fucosyltransferase activity towards type 2 chain acceptors. Loss of site-specific fucosylation leading to generation of approximately equal amounts of VIM2 and sialyl-lewis x. Reverse the site-specific fucosylation pattern leading to generation of VIM2 predominantly instead of sialyl-lewis x; when associated with T-73; D-111 and I-112. Increases VIM2 glycolipid product; when associated with T-73; D-111 and I-112.
Mutagenesis 111 – 111 E -> D. Reverse the site-specific fucosylation pattern leading to generation of VIM2 predominantly instead of sialyl-lewis x; when associated with T-73; W-110 and I-112. Increases VIM2 glycolipid product; when associated with T-73; W-110 and I-112.
Mutagenesis 112 – 112 V -> I. Reverse the site-specific fucosylation pattern leading to generation of VIM2 predominantly instead of sialyl-lewis x; when associated with T-73; W-110 and D-111. Increases VIM2 glycolipid product; when associated with T-73; W-110 and D-111.



Literature citations
Isolation and expression of human alpha-(1,3)-fucosyltransferase.
Rahim I.; Schmidt L.R.; Wahl D.; Drayson E.; Maslanik W.; Stranahan P.L.; Pettijohn D.E.;
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); VARIANT SER-124; Identification of two functionally deficient plasma alpha 3-fucosyltransferase (FUT6) alleles.
Elmgren A.; Borjeson C.; Mollicone R.; Oriol R.; Fletcher A.; Larson G.;
Hum. Mutat. 16:473-481(2000)
Cited for: VARIANTS SER-124; VAL-244; LYS-247 AND GLY-303; CHARACTERIZATION OF VARIANTS SER-124; VAL-244; LYS-247 AND GLY-303; Analysis of protein-coding genetic variation in 60,706 humans.
Lek M.; Karczewski K.J.; Minikel E.V.; Samocha K.E.; Banks E.; Fennell T.; O'Donnell-Luria A.H.; Ware J.S.; Hill A.J.; Cummings B.B.; Tukiainen T.; Birnbaum D.P.; Kosmicki J.A.; Duncan L.E.; Estrada K.; Zhao F.; Zou J.; Pierce-Hoffman E.; Berghout J.; Cooper D.N.; Deflaux N.; DePristo M.; Do R.; Flannick J.; Fromer M.; Gauthier L.; Goldstein J.; Gupta N.; Howrigan D.; Kiezun A.; Kurki M.I.; Moonshine A.L.; Natarajan P.; Orozco L.; Peloso G.M.; Poplin R.; Rivas M.A.; Ruano-Rubio V.; Rose S.A.; Ruderfer D.M.; Shakir K.; Stenson P.D.; Stevens C.; Thomas B.P.; Tiao G.; Tusie-Luna M.T.; Weisburd B.; Won H.H.; Yu D.; Altshuler D.M.; Ardissino D.; Boehnke M.; Danesh J.; Donnelly S.; Elosua R.; Florez J.C.; Gabriel S.B.; Getz G.; Glatt S.J.; Hultman C.M.; Kathiresan S.; Laakso M.; McCarroll S.; McCarthy M.I.; McGovern D.; McPherson R.; Neale B.M.; Palotie A.; Purcell S.M.; Saleheen D.; Scharf J.M.; Sklar P.; Sullivan P.F.; Tuomilehto J.; Tsuang M.T.; Watkins H.C.; Wilson J.G.; Daly M.J.; MacArthur D.G.;
Nature 536:285-291(2016)
Cited for: VARIANTS SER-124; LYS-247 AND GLY-303;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.