Home  |  Contact

UniProtKB/Swiss-Prot P06731: Variant p.Lys398Glu

Carcinoembryonic antigen-related cell adhesion molecule 5
Gene: CEACAM5
Variant information

Variant position:  398
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  LB/B
The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change:  From Lysine (K) to Glutamate (E) at position 398 (K398E, p.Lys398Glu).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and basic (K) to medium size and acidic (E)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  398
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  702
The length of the canonical sequence.

Location on the sequence:   LTLLSVTRNDVGPYECGIQN  K LSVDHSDPVILNVLYGPDDP
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         LTLLSVTRNDVGPYECGIQN----------KLSVDHS-----DPVILNVLYGPDD--------------P

Mouse                         LLLQRVMQNDTQFYTLQTMDTDLKYEVAHVQLQLDTSLSTW

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 35 – 685 Carcinoembryonic antigen-related cell adhesion molecule 5
Domain 323 – 410 Ig-like C2-type 3


Literature citations

Isolation and characterization of full-length functional cDNA clones for human carcinoembryonic antigen.
Beauchemin N.; Benchimol S.; Cournoyer D.; Fuks A.; Stanners C.P.;
Mol. Cell. Biol. 7:3221-3230(1987)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANT GLU-398;

Carcinoembryonic antigen family: characterization of cDNAs coding for NCA and CEA and suggestion of nonrandom sequence variation in their conserved loop-domains.
Barnett T.; Goebel S.J.; Nothdurft M.A.; Elting J.J.;
Genomics 3:59-66(1988)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); VARIANT GLU-398;

Cloning of the complete gene for carcinoembryonic antigen: analysis of its promoter indicates a region conveying cell type-specific expression.
Schrewe H.; Thompson J.; Bona M.; Hefta L.J.F.; Maruya A.; Hassauer M.; Shively J.E.; von Kleist S.; Zimmermann W.;
Mol. Cell. Biol. 10:2738-2748(1990)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANT GLU-398;

Primary structure of human carcinoembryonic antigen (CEA) deduced from cDNA sequence.
Oikawa S.; Nakazato H.; Kosaki G.;
Biochem. Biophys. Res. Commun. 142:511-518(1987)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 5-702 (ISOFORM 2); VARIANT GLU-398;

Isolation and characterization of cDNA clones encoding the human carcinoembryonic antigen reveal a highly conserved repeating structure.
Zimmermann W.; Ortlieb B.; Friedrich R.; von Kleist S.;
Proc. Natl. Acad. Sci. U.S.A. 84:2960-2964(1987)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 331-702 (ISOFORM 1); VARIANT GLU-398;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.