UniProtKB/SwissProt variant VAR

G protein-coupled receptor kinase 4
Gene: GRK4
Feedback?

Variant information Variant position:

142
Type of variant:

LB/B
Residue change:

From Alanine (A) to Valine (V) at position 142 (A142V, p.Ala142Val).
Physico-chemical properties:

Change from small size and hydrophobic (A) to medium size and hydrophobic (V)
BLOSUM score:

0
Other resources:

Variant rs1024323 [ dbSNP | Ensembl ]

Sequence information Variant position:

142
Protein sequence length:

578
Location on the sequence:

PPDVVTECRLGLKEENPSKK A FEECTRVAHNYLRGEPFEEY
Residue conservation:

Human                         PPDVVTECRLGLKEENPSKKAFEECTRVAHNYLRGEPFEEY

Mouse                         PPDIVKECKWNLKQNSPSQNVFEECAGIVCKYLSETPFEEY

Rat                           PPDLVKECKCNLKQSSPSQNVFQDCAGVIYKYLSEKPFEEY

Sequence annotation in neighborhood:

Type	Positions	Description
Chain	1 – 578	G protein-coupled receptor kinase 4
Domain	52 – 172	RGS
Region	1 – 154	N-terminal
Turn	140 – 143

Literature citations
Patterns of somatic mutation in human cancer genomes.
Greenman C.; Stephens P.; Smith R.; Dalgliesh G.L.; Hunter C.; Bignell G.; Davies H.; Teague J.; Butler A.; Stevens C.; Edkins S.; O'Meara S.; Vastrik I.; Schmidt E.E.; Avis T.; Barthorpe S.; Bhamra G.; Buck G.; Choudhury B.; Clements J.; Cole J.; Dicks E.; Forbes S.; Gray K.; Halliday K.; Harrison R.; Hills K.; Hinton J.; Jenkinson A.; Jones D.; Menzies A.; Mironenko T.; Perry J.; Raine K.; Richardson D.; Shepherd R.; Small A.; Tofts C.; Varian J.; Webb T.; West S.; Widaa S.; Yates A.; Cahill D.P.; Louis D.N.; Goldstraw P.; Nicholson A.G.; Brasseur F.; Looijenga L.; Weber B.L.; Chiew Y.-E.; DeFazio A.; Greaves M.F.; Green A.R.; Campbell P.; Birney E.; Easton D.F.; Chenevix-Trench G.; Tan M.-H.; Khoo S.K.; Teh B.T.; Yuen S.T.; Leung S.Y.; Wooster R.; Futreal P.A.; Stratton M.R.;
Nature 446:153-158(2007)
Cited for: VARIANTS [LARGE SCALE ANALYSIS] LEU-65; THR-116; VAL-142; ILE-247; GLN-383; PRO-425; ILE-473; ALA-486 AND THR-495;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P32298: Variant p.Ala142Val