UniProtKB/Swiss-Prot Q9UGM3: Variant p.Arg1176Trp

Scavenger receptor cysteine-rich domain-containing protein DMBT1
Gene: DMBT1
Feedback?

Variant information Variant position:

1176 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Arginine (R) to Tryptophan (W) at position 1176 (R1176W, p.Arg1176Trp). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from large size and basic (R) to large size and aromatic (W) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Polymorphism:

The number of SRCR and SRCR-interspersed domains is polymorphic in a variety of tumors and may represent the major site of alterations in cancer. Additional information on the polymorphism described.
Other resources:

Links to websites of interest for the variant.

Variant rs761527369 [ dbSNP | Ensembl ]

Sequence information Variant position:

1176 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

2413 The length of the canonical sequence.
Location on the sequence:

ANVVCRQLGCGWAMSAPGNA R FGQGSGPIVLDDVRCSGHES The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         ANVVCRQLGCGWAMSAPGNARFGQGSGPIVLDDVRCSGHES

Mouse                         ANVVCRQLGCGLAVSAPGSARFGQGTGPIVMDDVACGGYED

Rat                           ----------------PG------------------GTNND

Pig                           -----------------------------------------

Rabbit                        AQVVCRQLGCGMAVSAPGSARFGQGPGQIVLDDVSCSGQEP

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	20 – 2413	Scavenger receptor cysteine-rich domain-containing protein DMBT1
Domain	1122 – 1222	SRCR 9
Disulfide bond	1147 – 1211
Disulfide bond	1160 – 1221
Alternative sequence	344 – 1360	Missing. In isoform 9.
Alternative sequence	523 – 1408	Missing. In isoform 4.
Alternative sequence	1099 – 1356	Missing. In isoform 8.
Alternative sequence	1169 – 1169	M -> MSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQSQPTPSPDTWPTSHASTAGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWAT. In isoform 6 and isoform 7.
Alternative sequence	1170 – 1298	Missing. In isoform 2.

Literature citations
Rare mutations of the DMBT1 gene in human astrocytic gliomas.
Mueller W.; Mollenhauer J.; Stockhammer F.; Poustka A.; von Deimling A.;
Oncogene 21:5956-5959(2002)
Cited for: VARIANTS THR-42; TRP-52; LEU-54; ALA-60; LEU-65; LEU-337; SER-357; GLY-364; MET-649; MET-780; TYR-1084; THR-1169; TRP-1176; MET-1545; SER-1732 AND PRO-1961;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.