UniProtKB/Swiss-Prot P01833: Variant p.Gly365Ser

Polymeric immunoglobulin receptor
Gene: PIGR
Feedback?

Variant information Variant position:

365 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Glycine (G) to Serine (S) at position 365 (G365S, p.Gly365Ser). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from glycine (G) to small size and polar (S) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs2275531 [ dbSNP | Ensembl ]

Sequence information Variant position:

365 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

764 The length of the canonical sequence.
Location on the sequence:

FVNEESTIPRSPTVVKGVAG G SVAVLCPYNRKESKSIKYWC The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         FVNEESTIPRSPTVVKGVAGGSVAVLCPYNRKESKSIKYWC

Mouse                         FVNEESTIPNRRSVVKGVTGGSVAIACPYNPKESSSLKYWC

Rat                           FVNEESTIPNSRSVVKGVTGGSVAIVCPYNPKESSSLKYWC

Bovine                        FVNEETAIPASPSVVKGVRGGSVTVSCPYNPKDANSAKYWC

Rabbit                        FVNEEIDVSRSPPVLKGFPGGSVTIRCPYNPKRSDSHLQLY

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	19 – 764	Polymeric immunoglobulin receptor
Chain	19 – 603	Secretory component
Topological domain	19 – 638	Extracellular
Domain	364 – 458	Ig-like V-type 4
Beta strand	365 – 372

Literature citations
The human transmembrane secretory component (poly-Ig receptor): molecular cloning, restriction fragment length polymorphism and chromosomal sublocalization.
Krajci P.; Grzeschik K.H.; Geurts van Kessel A.H.; Olaisen B.; Brandtzaeg P.;
Hum. Genet. 87:642-648(1991)
Cited for: NUCLEOTIDE SEQUENCE [MRNA]; VARIANT SER-365; Molecular cloning and exon-intron mapping of the gene encoding human transmembrane secretory component (the poly-Ig receptor).
Krajci P.; Kvale D.; Tasken K.; Brandtzaeg P.;
Eur. J. Immunol. 22:2309-2315(1992)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANT SER-365; The full-ORF clone resource of the German cDNA consortium.
Bechtel S.; Rosenfelder H.; Duda A.; Schmidt C.P.; Ernst U.; Wellenreuther R.; Mehrle A.; Schuster C.; Bahr A.; Bloecker H.; Heubner D.; Hoerlein A.; Michel G.; Wedler H.; Koehrer K.; Ottenwaelder B.; Poustka A.; Wiemann S.; Schupp I.;
BMC Genomics 8:399-399(2007)
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]; VARIANT SER-365; Molecular cloning of the human transmembrane secretory component (poly-Ig receptor) and its mRNA expression in human tissues.
Krajci P.; Solberg R.; Sandberg M.; Oyen O.; Jahnsen T.; Brandtzaeg P.;
Biochem. Biophys. Res. Commun. 158:783-789(1989)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 72-764; VARIANT SER-365; The primary structure of human free secretory component and the arrangement of disulfide bonds.
Eiffert H.; Quentin E.; Decker J.; Hillemeir S.; Hufschmidt M.; Klingmueller D.; Weber M.H.; Hilschmann N.;
Hoppe-Seyler's Z. Physiol. Chem. 365:1489-1495(1984)
Cited for: PROTEIN SEQUENCE OF 19-577; VARIANT SER-365; DISULFIDE BONDS; GLYCOSYLATION AT ASN-83; ASN-90; ASN-135; ASN-186; ASN-421; ASN-469 AND ASN-499; Determination of the molecular structure of the human free secretory component.
Eiffert H.; Quentin E.; Wiederhold M.; Hillemeir S.; Decker J.; Weber M.; Hilschmann N.;
Biol. Chem. Hoppe-Seyler 372:119-128(1991)
Cited for: PROTEIN SEQUENCE OF 19-577; VARIANT SER-365;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.