Home  |  Contact

UniProtKB/Swiss-Prot O00187: Variant p.Arg118Cys

Mannan-binding lectin serine protease 2
Gene: MASP2
Chromosomal location: 1p36.2-p36.3
Variant information

Variant position:  118
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Polymorphism
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Arginine (R) to Cysteine (C) at position 118 (R118C, p.Arg118Cys).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and basic (R) to medium size and polar (C)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  118
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  686
The length of the canonical sequence.

Location on the sequence:   ERAPGKDTFYSLGSSLDITF  R SDYSNEKPFTGFEAFYAAED
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         ERAPGKDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYAAED

Mouse                         EQAPGNDTFYSLGPSLKVTFHSDYSNEKPFTGFEAFYAAED

Rat                           ERAPGNDTFYSLGPSLKVTFHSDYSNEKPFTGFEAFYAAED

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 16 – 686 Mannan-binding lectin serine protease 2
Chain 16 – 444 Mannan-binding lectin serine protease 2 A chain
Domain 16 – 137 CUB 1
Metal binding 120 – 120 Calcium 1
Metal binding 122 – 122 Calcium 1; via carbonyl oxygen
Metal binding 123 – 123 Calcium 1
Metal binding 138 – 138 Calcium 2
Mutagenesis 121 – 121 Y -> A. Strongly decreases affinity for MBL2, but not for FCN2.
Mutagenesis 124 – 124 E -> A. Decreases affinity for MBL2. Slight decrease in affinity for FCN2.
Beta strand 109 – 118


Literature citations

Novel MASP2 variants detected among North African and Sub-Saharan individuals.
Lozano F.; Suarez B.; Munoz A.; Jensenius J.C.; Mensa J.; Vives J.; Horcajada J.P.;
Tissue Antigens 66:131-135(2005)
Cited for: VARIANTS GLN-99; CYS-118; GLY-120 AND LEU-126;

Deficiency of mannan-binding lectin associated serine protease-2 due to missense polymorphisms.
Thiel S.; Steffensen R.; Christensen I.J.; Ip W.K.; Lau Y.L.; Reason I.J.; Eiberg H.; Gadjeva M.; Ruseva M.; Jensenius J.C.;
Genes Immun. 8:154-163(2007)
Cited for: VARIANTS MASPD GLY-120; LEU-126 AND HIS-ASN-HIS-156 INS; VARIANTS GLN-99; CYS-118 AND ALA-377; CHARACTERIZATION OF VARIANT ALA-377;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.