Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot O00187: Variant p.Pro126Leu

Mannan-binding lectin serine protease 2
Gene: MASP2
Feedback?
Variant information Variant position: help 126 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Proline (P) to Leucine (L) at position 126 (P126L, p.Pro126Leu). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In MASPD; likely benign. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 126 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 686 The length of the canonical sequence.
Location on the sequence: help FYSLGSSLDITFRSDYSNEK P FTGFEAFYAAEDIDECQVAP The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         FYSLGSSLDITFRSDYSNEKPFTGFEAFYAAEDIDECQVAP

Mouse                         FYSLGPSLKVTFHSDYSNEKPFTGFEAFYAAEDVDECRVSL

Rat                           FYSLGPSLKVTFHSDYSNEKPFTGFEAFYAAEDVDECRTSL

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 16 – 686 Mannan-binding lectin serine protease 2
Chain 16 – 444 Mannan-binding lectin serine protease 2 A chain
Domain 16 – 137 CUB 1
Binding site 120 – 120
Binding site 122 – 122
Binding site 123 – 123
Binding site 138 – 138
Binding site 139 – 139
Binding site 141 – 141
Mutagenesis 121 – 121 Y -> A. Strongly decreases affinity for MBL2, but not for FCN2.
Mutagenesis 124 – 124 E -> A. Decreases affinity for MBL2. Slight decrease in affinity for FCN2.



Literature citations
Novel MASP2 variants detected among North African and Sub-Saharan individuals.
Lozano F.; Suarez B.; Munoz A.; Jensenius J.C.; Mensa J.; Vives J.; Horcajada J.P.;
Tissue Antigens 66:131-135(2005)
Cited for: VARIANTS GLN-99; CYS-118; GLY-120 AND LEU-126;
Deficiency of mannan-binding lectin associated serine protease-2 due to missense polymorphisms.
Thiel S.; Steffensen R.; Christensen I.J.; Ip W.K.; Lau Y.L.; Reason I.J.; Eiberg H.; Gadjeva M.; Ruseva M.; Jensenius J.C.;
Genes Immun. 8:154-163(2007)
Cited for: VARIANTS MASPD GLY-120; LEU-126 AND HIS-ASN-HIS-156 INS; VARIANTS GLN-99; CYS-118 AND ALA-377; CHARACTERIZATION OF VARIANT ALA-377;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.