UniProtKB/Swiss-Prot Q9UIF7: Variant p.Gln411Arg

Adenine DNA glycosylase
Gene: MUTYH
Feedback?

Variant information Variant position:

411 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

US The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Glutamine (Q) to Arginine (R) at position 411 (Q411R, p.Gln411Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from medium size and polar (Q) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Variant description:

In GASC; uncertain significance; does not affect function in DNA repair. Any additional useful information about the variant.
Other resources:

Links to websites of interest for the variant.

Variant rs121908383 [ dbSNP | Ensembl ]

Sequence information Variant position:

411 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

546 The length of the canonical sequence.
Location on the sequence:

NSGLLAGLWEFPSVTWEPSE Q LQRKALLQELQRWAGPLPAT The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         NSGLLAGLWEFPSVTWEPSEQLQRKALLQELQRWAGPLPAT

Mouse                         DSGLLAGLWEFPSVTLEPSEQHQHKALLQELQRWCGPLPAI

Rat                           NSGLLAGLWEFPSVTLEPSGQHQHKALLQELQHWSAPLPTT

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 546	Adenine DNA glycosylase
Domain	364 – 495	Nudix hydrolase
Motif	404 – 426	Nudix box
Helix	410 – 424

Literature citations
Genetic alterations of the MYH gene in gastric cancer.
Kim C.J.; Cho Y.G.; Park C.H.; Kim S.Y.; Nam S.W.; Lee S.H.; Yoo N.J.; Lee J.Y.; Park W.S.;
Oncogene 23:6820-6822(2004)
Cited for: VARIANTS GASC SER-402 AND ARG-411; Functional complementation assay for 47 MUTYH variants in a MutY-disrupted Escherichia coli strain.
Komine K.; Shimodaira H.; Takao M.; Soeda H.; Zhang X.; Takahashi M.; Ishioka C.;
Hum. Mutat. 36:704-711(2015)
Cited for: CHARACTERIZATION OF VARIANTS FAP2 LEU-18; HIS-125; ARG-128; LEU-154; CYS-176; CYS-179; HIS-179; GLN-182; GLU-186; VAL-220; TRP-238; HIS-242; TRP-271; GLU-283; LEU-292; CYS-306; THR-377; PRO-385; ASP-393; LEU-402; MET-417; CYS-423; ASP-470; THR-470; GLU-477 DEL; THR-486 AND PHE-490; CHARACTERIZATION OF VARIANTS GASC SER-402 AND ARG-411; CHARACTERIZATION OF VARIANTS MET-22; ASP-25; ARG-100; ASN-102; VAL-224; MET-231; CYS-242; PHE-243; TRP-287; HIS-335; ARG-335; GLN-434; PRO-434; GLU-500; PHE-512; LEU-513; MET-526 AND GLN-531; FUNCTION; SUBCELLULAR LOCATION;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.