Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P51649: Variant p.Val487Glu

Succinate-semialdehyde dehydrogenase, mitochondrial
Gene: ALDH5A1
Feedback?
Variant information Variant position: help 487 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Valine (V) to Glutamate (E) at position 487 (V487E, p.Val487Glu). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and hydrophobic (V) to medium size and acidic (E) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In SSADHD. Any additional useful information about the variant.


Sequence information Variant position: help 487 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 535 The length of the canonical sequence.
Location on the sequence: help AGYFYSQDPAQIWRVAEQLE V GMVGVNEGLISSVECPFGGV The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         AGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSVECPFGGV

Gorilla                       AGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSVECPFGGV

Chimpanzee                    AGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSVECPFGGV

Mouse                         AGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSVECPFGGV

Rat                           AGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSVECPFGGV
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 48 – 535 Succinate-semialdehyde dehydrogenase, mitochondrial
Binding site 498 – 498
Modified residue 499 – 499 Phosphoserine
Mutagenesis 498 – 498 S -> A. Reduces catalytic activity to less than 15% of wild-type.
Beta strand 487 – 493



Literature citations
Mutation analysis in a patient with succinic semialdehyde dehydrogenase deficiency: a compound heterozygote with 103-121del and 1460T>A of the ALDH5A1 gene.
Aoshima T.; Kajita M.; Sekido Y.; Ishiguro Y.; Tsuge I.; Kimura M.; Yamaguchi S.; Watanabe K.; Shimokata K.; Niwa T.;
Hum. Hered. 53:42-44(2002)
Cited for: VARIANT SSADHD GLU-487;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.