Home  |  Contact

UniProtKB/Swiss-Prot P60484: Variant p.His123Tyr

Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
Gene: PTEN
Variant information

Variant position:  123
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Histidine (H) to Tyrosine (Y) at position 123 (H123Y, p.His123Tyr).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and polar (H) to large size and aromatic (Y)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  2
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  In endometrial cancer; loss of protein phosphatase activity.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  123
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  403
The length of the canonical sequence.

Location on the sequence:   PFCEDLDQWLSEDDNHVAAI  H CKAGKGRTGVMICAYLLHRG
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         PFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRG

                              PFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRG

Mouse                         PFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRG

Xenopus laevis                PFCEDLDQLLSENEN-VAAIHCKAGKGRTGVMICAYLLHRG

Caenorhabditis elegans        PFCREAKEWLEADDKHVIAVHCKAGKGRTGVMICALLIYIN

Slime mold                    AFCRDVDAWMKEDSKNIAVIHCKAGKGRTGLMICCWLMYCG

Fission yeast                 AIVMNMDALFQTQPLLTLVVHCKAGKGRTGTVICSYLVAFG

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 2 – 403 Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
Domain 14 – 185 Phosphatase tensin-type
Active site 124 – 124 Phosphocysteine intermediate
Mutagenesis 124 – 124 C -> A. Loss of protein phosphatase activity. Unable to inhibit focal adhesion formation.
Mutagenesis 125 – 125 K -> M. Reduced phosphatase activity towards PtdIns(3,4,5)P3, PtdIns(3,4)P2 and PtdIns(3)P.
Mutagenesis 126 – 126 A -> P. Does not reduce phosphatase activity towards PtdIns(3,4,5)P3 and PtdIns(3,4)P2.
Mutagenesis 126 – 126 A -> S. Does not reduce phosphatase activity towards PtdIns(3,4,5)P3 and PtdIns(3,4)P2.
Mutagenesis 126 – 126 A -> V. Does not reduce phosphatase activity towards PtdIns(3,4,5)P3 and PtdIns(3,4)P2.
Mutagenesis 128 – 128 K -> M. 85% reduction in phosphatase activity towards PtdIns(3,4,5)P3.
Mutagenesis 128 – 128 K -> R. Does not reduce phosphatase activity towards PtdIns(3,4,5)P3.
Mutagenesis 130 – 130 R -> M. Does not affect the ability to inhibit AKT/PKB activation.
Beta strand 118 – 123


Literature citations

P-TEN, the tumor suppressor from human chromosome 10q23, is a dual-specificity phosphatase.
Myers M.P.; Stolarov J.P.; Eng C.; Li J.; Wang S.I.; Wigler M.H.; Parsons R.; Tonks N.K.;
Proc. Natl. Acad. Sci. U.S.A. 94:9052-9057(1997)
Cited for: FUNCTION; CATALYTIC ACTIVITY; CHARACTERIZATION OF VARIANTS GLIOMA TRP-57; ENDOMETRIAL CANCER TYR-123; GLIOBLASTOMA ARG-129; CWS1 ARG-129; PROSTATE CANCER LEU-134; GLIOBLASTOMA ARG-165; BREAST CANCER PRO-167 AND BZ ARG-170;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.