Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q8TAM1: Variant p.Ser311Ala

BBSome complex assembly protein BBS10
Gene: BBS10
Feedback?
Variant information Variant position: help 311 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Serine (S) to Alanine (A) at position 311 (S311A, p.Ser311Ala). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from small size and polar (S) to small size and hydrophobic (A) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In BBS10; has moderately reduced ability to interact with BBS7 and BBS9; severely reduces the interaction with BBS12; 19% of wild-type. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 311 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 723 The length of the canonical sequence.
Location on the sequence: help MEKTKAIMKHLHSQNVKLLI S SVKQPDLVSYYAGVNGISVV The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         MEKTKAIMKHLHSQNVKLLISSVKQPDLVSYYAGVNGISVV

Mouse                         TDRTKTVMNHLRGQNVKLLLTSVKQPDLVIYCARLNSISVV

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 723 BBSome complex assembly protein BBS10



Literature citations
Pitfalls of homozygosity mapping: an extended consanguineous Bardet-Biedl syndrome family with two mutant genes (BBS2, BBS10), three mutations, but no triallelism.
Laurier V.; Stoetzel C.; Muller J.; Thibault C.; Corbani S.; Jalkh N.; Salem N.; Chouery E.; Poch O.; Licaire S.; Danse J.M.; Amati-Bonneau P.; Bonneau D.; Megarbane A.; Mandel J.L.; Dollfus H.;
Eur. J. Hum. Genet. 14:1195-1203(2006)
Cited for: INVOLVEMENT IN BBS10; VARIANTS BBS10 GLY-11 AND ALA-311; BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly.
Seo S.; Baye L.M.; Schulz N.P.; Beck J.S.; Zhang Q.; Slusarski D.C.; Sheffield V.C.;
Proc. Natl. Acad. Sci. U.S.A. 107:1488-1493(2010)
Cited for: FUNCTION; IDENTIFICATION IN A MULTIPROTEIN COMPLEX; CHARACTERIZATION OF VARIANTS BBS10 PRO-34; TRP-49; TRP-91; GLY-240; PHE-308; ALA-311; LEU-329; LEU-363; HIS-613; VAL-677 AND PRO-689; MUTAGENESIS OF ASP-81; BBS10 encodes a vertebrate-specific chaperonin-like protein and is a major BBS locus.
Stoetzel C.; Laurier V.; Davis E.E.; Muller J.; Rix S.; Badano J.L.; Leitch C.C.; Salem N.; Chouery E.; Corbani S.; Jalk N.; Vicaire S.; Sarda P.; Hamel C.; Lacombe D.; Holder M.; Odent S.; Holder S.; Brooks A.S.; Elcioglu N.H.; Da Silva E.; Rossillion B.; Sigaudy S.; de Ravel T.J.; Alan Lewis R.; Leheup B.; Verloes A.; Amati-Bonneau P.; Megarbane A.; Poch O.; Bonneau D.; Beales P.L.; Mandel J.-L.; Katsanis N.; Dollfus H.;
Nat. Genet. 38:521-524(2006)
Cited for: VARIANTS BBS10 PRO-34; TRP-49; TRP-91; SER-170; TRP-195; CYS-197; GLY-240; PHE-308; ALA-311; LEU-329; LEU-363; SER-414; ARG-579; HIS-613; CYS-613; VAL-677 AND PRO-689;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.