Home  |  Contact

UniProtKB/Swiss-Prot Q8NG31: Variant p.Arg936Gly

Kinetochore scaffold 1
Gene: KNL1
Variant information

Variant position:  936
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  LB/B
The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change:  From Arginine (R) to Glycine (G) at position 936 (R936G, p.Arg936Gly).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and basic (R) to glycine (G)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -2
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  936
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  2342
The length of the canonical sequence.

Location on the sequence:   KRDCHLVPLAGTSETILYTC  R QDDMEITRSHTTALECKTVS
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         KRDCHLVPLAGTSETILYTCRQDDMEITRSHTTALECKTVS

Mouse                         KHDSHLVSLAGTSKTILHARGQVEMEINRSHTTPLECKIIS

Caenorhabditis elegans        DDGSSKTPV-----------------ILASQSASLATK---

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 2342 Kinetochore scaffold 1
Repeat 885 – 989 1
Region 855 – 1201 2 X 104 AA approximate repeats
Modified residue 956 – 956 Phosphoserine


Literature citations

AF15q14, a novel partner gene fused to the MLL gene in an acute myeloid leukaemia with a t(11;15)(q23;q14).
Hayette S.; Tigaud I.; Vanier A.; Martel S.; Corbo L.; Charrin C.; Beillard E.; Deleage G.; Magaud J.-P.; Rimokh R.;
Oncogene 19:4446-4450(2000)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 4); CHROMOSOMAL TRANSLOCATION WITH KMT2A/MLL1; SUBCELLULAR LOCATION; TISSUE SPECIFICITY; VARIANTS SER-486; THR-598; GLY-936; GLU-1285 AND ALA-1473;

Frequent expression of new cancer/testis gene D40/AF15q14 in lung cancer of smokers.
Takimoto M.; Wei G.; Dosaka-Akita H.; Mao P.; Kondo S.; Sakuragi N.; Chiba I.; Miura T.; Itoh N.; Sasao T.; Koya R.C.; Tsukamoto T.; Fujimoto S.; Kato H.; Kuzumaki N.;
Br. J. Cancer 86:1757-1762(2002)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3); TISSUE SPECIFICITY; VARIANTS THR-43; ALA-113; SER-486; THR-598 AND GLY-936;

Characterization of the MLL partner gene AF15q14 involved in t(11;15)(q23;q14).
Kuefer M.U.; Chinwalla V.; Zeleznik-Le N.J.; Behm F.G.; Naeve C.W.; Rakestraw K.M.; Mukatira S.T.; Raimondi S.C.; Morris S.W.;
Oncogene 22:1418-1424(2003)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); CHROMOSOMAL TRANSLOCATION WITH KMT2A/MLL1; TISSUE SPECIFICITY; VARIANTS THR-598 AND GLY-936;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.