Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P31645: Variant p.Ile425Val

Sodium-dependent serotonin transporter
Gene: SLC6A4
Feedback?
Variant information Variant position: help 425 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Isoleucine (I) to Valine (V) at position 425 (I425V, p.Ile425Val). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Polymorphism: help A polymorphism in the promoter region (5-HTT gene-linked polymorphic region, 5-HTTLPR) is located approximately 1 kb upstream of the transcription initiation site and is composed of 16 repeat elements. The polymorphism consists of a 44-bp insertion or deletion involving repeat elements 6 to 8. The short allele is associated with lower transcriptional efficiency of the promoter compared with the long allele. Over half of the Caucasian population has a short allele. Individuals with one or two copies of the short allele exhibit more depressive symptoms, diagnosable depression and suicidality in relation to stressful life events than individuals homozygous for the long allele.The 5-HTTLPR polymorphism may influence susceptibility to anxiety [MIM:607834]. - The polymorphism Val-425 seems to be linked to a susceptibility to obsessive-compulsive disorder (OCD) [MIM:164230]. - Genetic variations in SLC6A4 determine the genetic susceptibility to alcoholism [MIM:103780]. - Polymorphisms that alter SLC6A4 expression or function may increase the susceptibility to autism. - Additional information on the polymorphism described.
Variant description: help Linked with susceptibility to obsessive-compulsive disorder; increased serotonin transport capacity. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 425 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 630 The length of the canonical sequence.
Location on the sequence: help LLFITYAEAIANMPASTFFA I IFFLMLITLGLDSTFAGLEG The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         LLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEG

Rhesus macaque                LLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEG

Mouse                         LLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEG

Rat                           LLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEG

Bovine                        LLFITYAEAIANMPASTFFAIVFFLMLITLGLDSTFAGLEG

Drosophila                    LVFIVYPEAIATMSGSVFWSIIFFLMLITLGLDSTFGGLEA

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 630 Sodium-dependent serotonin transporter
Transmembrane 422 – 443 Helical; Name=8
Binding site 434 – 434
Binding site 437 – 437
Binding site 438 – 438
Binding site 439 – 439
Helix 420 – 453



Literature citations
Serotonin transporter phosphorylation by cGMP-dependent protein kinase is altered by a mutation associated with obsessive compulsive disorder.
Zhang Y.W.; Gesmonde J.; Ramamoorthy S.; Rudnick G.;
J. Neurosci. 27:10878-10886(2007)
Cited for: PHOSPHORYLATION AT THR-276; VARIANT VAL-425;
Serotonin transporter missense mutation associated with a complex neuropsychiatric phenotype.
Ozaki N.; Goldman D.; Kaye W.H.; Plotnicov K.; Greenberg B.D.; Lappalainen J.; Rudnick G.; Murphy D.L.;
Mol. Psychiatry 8:933-936(2003)
Cited for: VARIANT VAL-425;
A human serotonin transporter mutation causes constitutive activation of transport activity.
Kilic F.; Murphy D.L.; Rudnick G.;
Mol. Pharmacol. 64:440-446(2003)
Cited for: CHARACTERIZATION OF VARIANT VAL-425; FUNCTION; TRANSPORTER ACTIVITY; BIOPHYSICOCHEMICAL PROPERTIES; SUBCELLULAR LOCATION;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.