Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q76LX8: Variant p.Arg1123Cys

A disintegrin and metalloproteinase with thrombospondin motifs 13
Gene: ADAMTS13
Feedback?
Variant information Variant position: help 1123 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Arginine (R) to Cysteine (C) at position 1123 (R1123C, p.Arg1123Cys). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to medium size and polar (C) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In TTP; impairs protein secretion; the mutant protein has reduced protease activity. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 1123 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1427 The length of the canonical sequence.
Location on the sequence: help QAQAPVPADFCQHLPKPVTV R GCWAGPCVGQGTPSLVPHEE The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         QAQAPVPADFCQHLPKPVTVRGCWAGPCVGQGTPSLVPHEE

Mouse                         QAQVPVPANFCQHLPKPMTVRGCWAGPCAGQETSSSLPHKE

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 75 – 1427 A disintegrin and metalloproteinase with thrombospondin motifs 13
Domain 1072 – 1131 TSP type-1 8
Alternative sequence 693 – 1427 Missing. In isoform 4.



Literature citations
Molecular characterization of ADAMTS13 gene mutations in Japanese patients with Upshaw-Schulman syndrome.
Matsumoto M.; Kokame K.; Soejima K.; Miura M.; Hayashi S.; Fujii Y.; Iwai A.; Ito E.; Tsuji Y.; Takeda-Shitaka M.; Iwadate M.; Umeyama H.; Yagi H.; Ishizashi H.; Banno F.; Nakagaki T.; Miyata T.; Fujimura Y.;
Blood 103:1305-1310(2004)
Cited for: VARIANTS TTP TRP-193; PHE-673; TYR-908 AND CYS-1123; VARIANT GLU-448; CHARACTERIZATION OF VARIANTS TTP TRP-193; PHE-673; TYR-908 AND CYS-1123; In-vitro and in-vivo consequences of mutations in the von Willebrand factor cleaving protease ADAMTS13 in thrombotic thrombocytopenic purpura.
Donadelli R.; Banterla F.; Galbusera M.; Capoferri C.; Bucchioni S.; Gastoldi S.; Nosari S.; Monteferrante G.; Ruggeri Z.M.; Bresin E.; Scheiflinger F.; Rossi E.; Martinez C.; Coppo R.; Remuzzi G.; Noris M.;
Thromb. Haemost. 96:454-464(2006)
Cited for: VARIANTS TTP TRP-1060; CYS-1123 AND TRP-1219; CHARACTERIZATION OF VARIANTS TTP TRP-1060; CYS-1123 AND TRP-1219; VARIANT GLU-448;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.