Home  |  Contact

UniProtKB/Swiss-Prot O43464: Variant p.Ala141Ser

Serine protease HTRA2, mitochondrial
Gene: HTRA2
Variant information

Variant position:  141
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  LB/B
The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change:  From Alanine (A) to Serine (S) at position 141 (A141S, p.Ala141Ser).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from small size and hydrophobic (A) to small size and polar (S)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  May be a risk factor for Parkinson disease; reduced protease activity.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  141
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  458
The length of the canonical sequence.

Location on the sequence:   LWGGGRGPPAVLAAVPSPPP  A SPRSQYNFIADVVEKTAPAV
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         LWGGGRGPPAVLAAVPSPPPASPRSQYNFIADVVEKTAPAV

Mouse                         LWGWGRGLSTVLAAVPAPPPTSPRSQYNFIADVVEKTAPAV

Bovine                        FWGGGRGPPAVLASVLGSPPTSPRSQYNFIADVVEKTAPAV

Drosophila                    IIQREDLTPTIAASKM----TGRRRDFNFIADVVAGCADSV

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 134 – 458 Serine protease HTRA2, mitochondrial
Mutagenesis 134 – 134 A -> M. Loss of interaction with XIAP. Loss of inhibition of XIAP activity.


Literature citations

Loss of function mutations in the gene encoding Omi/HtrA2 in Parkinson's disease.
Strauss K.M.; Martins L.M.; Plun-Favreau H.; Marx F.P.; Kautzmann S.; Berg D.; Gasser T.; Wszolek Z.; Mueller T.; Bornemann A.; Wolburg H.; Downward J.; Riess O.; Schulz J.B.; Krueger R.;
Hum. Mol. Genet. 14:2099-2111(2005)
Cited for: INVOLVEMENT IN PARK13; VARIANTS SER-141 AND SER-399; CHARACTERIZATION OF VARIANTS SER-141 AND SER-399;

Genetic variability in the mitochondrial serine protease HTRA2 contributes to risk for Parkinson disease.
Bogaerts V.; Nuytemans K.; Reumers J.; Pals P.; Engelborghs S.; Pickut B.; Corsmit E.; Peeters K.; Schymkowitz J.; De Deyn P.P.; Cras P.; Rousseau F.; Theuns J.; Van Broeckhoven C.;
Hum. Mutat. 29:832-840(2008)
Cited for: INVOLVEMENT IN PARK13; VARIANTS PRO-72 AND SER-141; VARIANT PARK13 TRP-404;

Sequencing analysis of OMI/HTRA2 shows previously reported pathogenic mutations in neurologically normal controls.
Simon-Sanchez J.; Singleton A.B.;
Hum. Mol. Genet. 17:1988-1993(2008)
Cited for: VARIANTS CYS-12; LEU-128; SER-141; SER-227 AND SER-399;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.