UniProtKB/Swiss-Prot Q15848: Variant p.Gly90Ser

Adiponectin
Gene: ADIPOQ
Feedback?

Variant information Variant position:

90 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Glycine (G) to Serine (S) at position 90 (G90S, p.Gly90Ser). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from glycine (G) to small size and polar (S) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Polymorphism:

Genetic variations in ADIPOQ influence the variance in adiponectin serum levels and define the adiponectin serum levels quantitative trait locus 1 (ADIPQTL1) [MIM:612556]. Additional information on the polymorphism described.
Variant description:

Does not form high molecular weight multimers. Any additional useful information about the variant.
Other resources:

Links to websites of interest for the variant.

Variant rs62625753 [ dbSNP | Ensembl ]

Sequence information Variant position:

90 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

244 The length of the canonical sequence.
Location on the sequence:

DPGLIGPKGDIGETGVPGAE G PRGFPGIQGRKGEPGEGAYV The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         DPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYV

Mouse                         DAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYV

Bovine                        DPGLVGPKGDTGETGITGIEGPRGFPGTPGRKGEPGESAYV

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	19 – 244	Adiponectin
Domain	42 – 107	Collagen-like
Region	40 – 101	Disordered
Site	86 – 86	Not hydroxylated
Site	104 – 104	Not hydroxylated
Modified residue	71 – 71	4-hydroxyproline; partial
Modified residue	76 – 76	4-hydroxyproline; partial
Modified residue	77 – 77	5-hydroxylysine
Modified residue	91 – 91	4-hydroxyproline
Modified residue	95 – 95	4-hydroxyproline; partial
Modified residue	101 – 101	5-hydroxylysine
Glycosylation	77 – 77	O-linked (Gal...) hydroxylysine; partial
Glycosylation	101 – 101	O-linked (Gal...) hydroxylysine; partial
Mutagenesis	77 – 77	K -> R. Impaired formation of HMW multimers; when associated with R-101.
Mutagenesis	101 – 101	K -> R. Impaired formation of HMW multimers; when associated with R-77.

Literature citations
Impaired multimerization of human adiponectin mutants associated with diabetes. Molecular structure and multimer formation of adiponectin.
Waki H.; Yamauchi T.; Kamon J.; Ito Y.; Uchida S.; Kita S.; Hara K.; Hada Y.; Vasseur F.; Froguel P.; Kimura S.; Nagai R.; Kadowaki T.;
J. Biol. Chem. 278:40352-40363(2003)
Cited for: SUBUNIT; DISULFIDE BOND; MUTAGENESIS OF CYS-36; CHARACTERIZATION OF VARIANTS ARG-84; SER-90; CYS-112 AND THR-164; Single-nucleotide polymorphism haplotypes in the both proximal promoter and exon 3 of the APM1 gene modulate adipocyte-secreted adiponectin hormone levels and contribute to the genetic risk for type 2 diabetes in French Caucasians.
Vasseur F.; Helbecque N.; Dina C.; Lobbens S.; Delannoy V.; Gaget S.; Boutin P.; Vaxillaire M.; Lepretre F.; Dupont S.; Hara K.; Clement K.; Bihain B.; Kadowaki T.; Froguel P.;
Hum. Mol. Genet. 11:2607-2614(2002)
Cited for: VARIANTS ARG-84; SER-90 AND HIS-111;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.