UniProtKB/SwissProt variant VAR

Variant information

Variant position:

111

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:

LB/B

The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Tyrosine (Y) to Histidine (H) at position 111 (Y111H, p.Tyr111His).

Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:

Change from large size and aromatic (Y) to medium size and polar (H)

The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:

2

The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page

Polymorphism:

Genetic variations in ADIPOQ influence the variance in adiponectin serum levels and define the adiponectin serum levels quantitative trait locus 1 (ADIPQTL1) [MIM:612556].

Additional information on the polymorphism described.

Other resources:

Links to websites of interest for the variant.

Variant rs17366743 [ dbSNP | Ensembl ]

Sequence information

Variant position:

111

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:

244

The length of the canonical sequence.

Location on the sequence:

PRGFPGIQGRKGEPGEGAYV Y RSAFSVGLETYVTIPNMPIR

The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         PRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIR

Mouse                         PRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIR

Bovine                        PRGFPGTPGRKGEPGESAYVYRSAFSVGLERQVTVPNVPIR

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	19 – 244	Adiponectin
Domain	108 – 244	C1q
Site	104 – 104	Not hydroxylated
Modified residue	91 – 91	4-hydroxyproline
Modified residue	95 – 95	4-hydroxyproline; partial
Modified residue	101 – 101	5-hydroxylysine
Glycosylation	101 – 101	O-linked (Gal...) hydroxylysine; partial
Mutagenesis	101 – 101	K -> R. Impaired formation of HMW multimers; when associated with R-77.

Literature citations

Single-nucleotide polymorphism haplotypes in the both proximal promoter and exon 3 of the APM1 gene modulate adipocyte-secreted adiponectin hormone levels and contribute to the genetic risk for type 2 diabetes in French Caucasians.
Vasseur F.; Helbecque N.; Dina C.; Lobbens S.; Delannoy V.; Gaget S.; Boutin P.; Vaxillaire M.; Lepretre F.; Dupont S.; Hara K.; Clement K.; Bihain B.; Kadowaki T.; Froguel P.;
Hum. Mol. Genet. 11:2607-2614(2002)
Cited for: VARIANTS ARG-84; SER-90 AND HIS-111;

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q15848: Variant p.Tyr111His