UniProtKB/Swiss-Prot P29279: Variant p.His83Asp

CCN family member 2
Gene: CCN2
Feedback?

Variant information Variant position:

83 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Histidine (H) to Aspartate (D) at position 83 (H83D, p.His83Asp). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from medium size and polar (H) to medium size and acidic (D) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs7451102 [ dbSNP | Ensembl ]

Sequence information Variant position:

83 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

349 The length of the canonical sequence.
Location on the sequence:

QLGELCTERDPCDPHKGLFC H FGSPANRKIGVCTAKDGAPC The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         QLGELCTERDPCDPHKGLFCHFGSPANRKIGVCTAKDGAPC

Mouse                         QLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPC

Rat                           QLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPC

Pig                           QLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPC

Bovine                        QLSELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPC

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	27 – 349	CCN family member 2
Domain	27 – 98	IGFBP N-terminal
Disulfide bond	74 – 95

Literature citations
Connective tissue growth factor: a cysteine-rich mitogen secreted by human vascular endothelial cells is related to the SRC-induced immediate early gene product CEF-10.
Bradham D.M.; Igarashi A.; Potter R.L.; Grotendorst G.R.;
J. Cell Biol. 114:1285-1294(1991)
Cited for: NUCLEOTIDE SEQUENCE [MRNA]; SUBUNIT; VARIANT ASP-83; Connective tissue growth factor.
Igarashi A.; Bradham D.M.; Okochi H.; Grotendorst G.R.;
J. Dermatol. 19:642-643(1992)
Cited for: NUCLEOTIDE SEQUENCE [MRNA]; VARIANT ASP-83; Human connective tissue growth factor is expressed in advanced atherosclerotic lesions.
Oemar B.S.; Werner A.; Garnier J.-M.; Do D.D.; Godoy N.; Nauck M.; Marz W.; Rupp J.; Pech M.; Luescher T.F.;
Circulation 95:831-839(1997)
Cited for: NUCLEOTIDE SEQUENCE [MRNA]; VARIANT ASP-83; Expression, purification and bio-activity of human connective tissue growth factor.
Li Q.-H.; Wang L.-C.; Liu L.-D.; Dong S.-Z.; Wang J.-J.; Hu F.; Wang J.; He S.-Q.; Dong C.-H.; Zhao S.-D.; Zhao H.-L.;
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); VARIANT ASP-83; Complete mRNA sequence of human connective tissue growth factor.
Dai W.-J.; Jiang H.-C.; Fu S.-B.;
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); VARIANT ASP-83; Cloning of human full-length CDSs in BD Creator(TM) system donor vector.
Kalnine N.; Chen X.; Rolfs A.; Halleck A.; Hines L.; Eisenstein S.; Koundinya M.; Raphael J.; Moreira D.; Kelley T.; LaBaer J.; Lin Y.; Phelan M.; Farmer A.;
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1); VARIANT ASP-83; Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201).
Halleck A.; Ebert L.; Mkoundinya M.; Schick M.; Eisenstein S.; Neubert P.; Kstrang K.; Schatten R.; Shen B.; Henze S.; Mar W.; Korn B.; Zuo D.; Hu Y.; LaBaer J.;
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1); VARIANT ASP-83; Connective tissue growth factor mRNA is expressed in human keratinocytes as an immediate early gene that responds to serum, EGF, or wounding.
Cody C.W.; Walker N.J.; Greenlee W.F.; Sutter T.R.;
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 75-349; VARIANT ASP-83;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.