UniProtKB/Swiss-Prot P37173: Variant p.Val439Ala

TGF-beta receptor type-2
Gene: TGFBR2
Feedback?

Variant information Variant position:

439 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Valine (V) to Alanine (A) at position 439 (V439A, p.Val439Ala). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from medium size and hydrophobic (V) to small size and hydrophobic (A) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs1050833 [ dbSNP | Ensembl ]

Sequence information Variant position:

439 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

567 The length of the canonical sequence.
Location on the sequence:

VGTARYMAPEVLESRMNLEN V ESFKQTDVYSMALVLWEMTS The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         VGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTS

Mouse                         VGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTS

Rat                           VGTARYMAPEVLESRMNLENMESFKQTDVYSMALVLWEMTS

Chicken                       VGTARYMAPEVLESRMNLENMESFKQTDVYSMALVLWEMTS

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	23 – 567	TGF-beta receptor type-2
Topological domain	188 – 567	Cytoplasmic
Domain	244 – 544	Protein kinase
Region	439 – 567	Sufficient for interaction with CLU
Alternative sequence	81 – 567	Missing. In isoform 3.

Literature citations
Expression cloning of the TGF-beta type II receptor, a functional transmembrane serine/threonine kinase.
Lin H.Y.; Wang X.-F.; Ng-Eaton E.; Weinberg R.A.; Lodish H.F.;
Cell 68:775-785(1992)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); VARIANT ALA-439; SUBCELLULAR LOCATION; The genomic structure of the gene encoding the human transforming growth factor beta type II receptor (TGF-beta RII).
Takenoshita S.; Hagiwara K.; Nagashima M.; Gemma A.; Bennett W.P.; Harris C.C.;
Genomics 36:341-344(1996)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1); VARIANT ALA-439; Genomic structure of the transforming growth factor beta type II receptor gene and its mutations in hereditary nonpolyposis colorectal cancers.
Lu S.-L.; Zhang W.C.; Akiyama Y.; Nomizu T.; Yuasa Y.;
Cancer Res. 56:4595-4598(1996)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1); VARIANT ALA-439; Cloning of a cDNA encoding the human transforming growth factor-beta type II receptor: heterogeneity of the mRNA.
Ogasa H.; Noma T.; Murata H.; Kawai S.; Nakazawa A.;
Gene 181:185-190(1996)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); VARIANT ALA-439;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.