Home  |  Contact

UniProtKB/Swiss-Prot Q9NSU2: Variant p.Arg114His

Three-prime repair exonuclease 1
Gene: TREX1
Variant information

Variant position:  114
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  LP/P [Disclaimer]
The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change:  From Arginine (R) to Histidine (H) at position 114 (R114H, p.Arg114His).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and basic (R) to medium size and polar (H)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  In AGS1 and SLE; primary fibroblasts from an AGS1 patient carrying H-169 show defective G1/S transition and chronic G2/M DNA damage checkpoint activation; strongly reduces activity.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  114
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  314
The length of the canonical sequence.

Location on the sequence:   AHGRQCFDDNLANLLLAFLR  R QPQPWCLVAHNGDRYDFPLL
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         AHGRQCFDDNLANLLLAFLRRQPQPWCLVAHNGDRYDFPLL

Mouse                         VQGRQRFDDNLAILLRAFLQRQPQPCCLVAHNGDRYDFPLL

Bovine                        AHGRRAFDADLVNLIRTFLQRQPQPWCLVAHNGDRYDFPLL

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 314 Three-prime repair exonuclease 1
Binding site 129 – 129 Substrate


Literature citations

Trex1 exonuclease degrades ssDNA to prevent chronic checkpoint activation and autoimmune disease.
Yang Y.G.; Lindahl T.; Barnes D.E.;
Cell 131:873-886(2007)
Cited for: FUNCTION IN CELL CYCLE REGULATION; CHARACTERIZATION OF VARIANT AGS1 HIS-114;

The crystal structure of TREX1 explains the 3' nucleotide specificity and reveals a polyproline II helix for protein partnering.
de Silva U.; Choudhury S.; Bailey S.L.; Harvey S.; Perrino F.W.; Hollis T.;
J. Biol. Chem. 282:10537-10543(2007)
Cited for: FUNCTION; CHARACTERIZATION OF VARIANTS AGS1 HIS-114; ASP-200 INS AND ASP-201;

Mutations in the gene encoding the 3'-5' DNA exonuclease TREX1 cause Aicardi-Goutieres syndrome at the AGS1 locus.
Crow Y.J.; Hayward B.E.; Parmar R.; Robins P.; Leitch A.; Ali M.; Black D.N.; van Bokhoven H.; Brunner H.G.; Hamel B.C.J.; Corry P.C.; Cowan F.M.; Frints S.G.; Klepper J.; Livingston J.H.; Lynch S.A.; Massey R.F.; Meritet J.F.; Michaud J.L.; Ponsot G.; Voit T.; Lebon P.; Bonthron D.T.; Jackson A.P.; Barnes D.E.; Lindahl T.;
Nat. Genet. 38:917-920(2006)
Cited for: VARIANTS AGS1 HIS-114; ASP-200 INS AND ASP-201;

Clinical and molecular phenotype of Aicardi-Goutieres syndrome.
Rice G.; Patrick T.; Parmar R.; Taylor C.F.; Aeby A.; Aicardi J.; Artuch R.; Montalto S.A.; Bacino C.A.; Barroso B.; Baxter P.; Benko W.S.; Bergmann C.; Bertini E.; Biancheri R.; Blair E.M.; Blau N.; Bonthron D.T.; Briggs T.; Brueton L.A.; Brunner H.G.; Burke C.J.; Carr I.M.; Carvalho D.R.; Chandler K.E.; Christen H.J.; Corry P.C.; Cowan F.M.; Cox H.; D'Arrigo S.; Dean J.; De Laet C.; De Praeter C.; Dery C.; Ferrie C.D.; Flintoff K.; Frints S.G.; Garcia-Cazorla A.; Gener B.; Goizet C.; Goutieres F.; Green A.J.; Guet A.; Hamel B.C.; Hayward B.E.; Heiberg A.; Hennekam R.C.; Husson M.; Jackson A.P.; Jayatunga R.; Jiang Y.H.; Kant S.G.; Kao A.; King M.D.; Kingston H.M.; Klepper J.; van der Knaap M.S.; Kornberg A.J.; Kotzot D.; Kratzer W.; Lacombe D.; Lagae L.; Landrieu P.G.; Lanzi G.; Leitch A.; Lim M.J.; Livingston J.H.; Lourenco C.M.; Lyall E.G.; Lynch S.A.; Lyons M.J.; Marom D.; McClure J.P.; McWilliam R.; Melancon S.B.; Mewasingh L.D.; Moutard M.L.; Nischal K.K.; Ostergaard J.R.; Prendiville J.; Rasmussen M.; Rogers R.C.; Roland D.; Rosser E.M.; Rostasy K.; Roubertie A.; Sanchis A.; Schiffmann R.; Scholl-Burgi S.; Seal S.; Shalev S.A.; Corcoles C.S.; Sinha G.P.; Soler D.; Spiegel R.; Stephenson J.B.; Tacke U.; Tan T.Y.; Till M.; Tolmie J.L.; Tomlin P.; Vagnarelli F.; Valente E.M.; Van Coster R.N.; Van der Aa N.; Vanderver A.; Vles J.S.; Voit T.; Wassmer E.; Weschke B.; Whiteford M.L.; Willemsen M.A.; Zankl A.; Zuberi S.M.; Orcesi S.; Fazzi E.; Lebon P.; Crow Y.J.;
Am. J. Hum. Genet. 81:713-725(2007)
Cited for: VARIANTS AGS1 HIS-114; ALA-122; ASN-200; ASP-201 AND PRO-303;

Mutations in the gene encoding the 3'-5' DNA exonuclease TREX1 are associated with systemic lupus erythematosus.
Lee-Kirsch M.A.; Gong M.; Chowdhury D.; Senenko L.; Engel K.; Lee Y.A.; de Silva U.; Bailey S.L.; Witte T.; Vyse T.J.; Kere J.; Pfeiffer C.; Harvey S.; Wong A.; Koskenmies S.; Hummel O.; Rohde K.; Schmidt R.E.; Dominiczak A.F.; Gahr M.; Hollis T.; Perrino F.W.; Lieberman J.; Huebner N.;
Nat. Genet. 39:1065-1067(2007)
Cited for: VARIANTS SLE HIS-114; VAL-158; SER-227; SER-240; PRO-247; LEU-290; CYS-305 AND ALA-306; VARIANT GLY-266;

Expanding the phenotypic spectrum of lupus erythematosus in Aicardi-Goutieres syndrome.
Ramantani G.; Kohlhase J.; Hertzberg C.; Innes A.M.; Engel K.; Hunger S.; Borozdin W.; Mah J.K.; Ungerath K.; Walkenhorst H.; Richardt H.H.; Buckard J.; Bevot A.; Siegel C.; von Stuelpnagel C.; Ikonomidou C.; Thomas K.; Proud V.; Niemann F.; Wieczorek D.; Haeusler M.; Niggemann P.; Baltaci V.; Conrad K.; Lebon P.; Lee-Kirsch M.A.;
Arthritis Rheum. 62:1469-1477(2010)
Cited for: VARIANTS AGS1 HIS-114; LYS-198 AND HIS-200; VARIANT SLE HIS-200;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.