Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q99743: Variant p.Ser471Leu

Neuronal PAS domain-containing protein 2
Gene: NPAS2
Feedback?
Variant information Variant position: help 471 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Serine (S) to Leucine (L) at position 471 (S471L, p.Ser471Leu). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from small size and polar (S) to medium size and hydrophobic (L) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Polymorphism: help Variants in NPAS2 show a susceptibility to seasonal affective disorder (SAD) [MIM:608516]. SAD is a depressive condition resulting from seasonal changes, and with diurnal preference. Additional information on the polymorphism described.
Variant description: help Susceptibility to seasonal affective disorder (SAD) and diurnal preference. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 471 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 824 The length of the canonical sequence.
Location on the sequence: help ELPVPGLSQAATMPAPLPSP S SCDLTQQLLPQTVLQSTPAP The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         ELPVPGLSQAATMPAPLPSPSSCDLTQQL----LPQTVLQSTPAP

Mouse                         ELPVQGLSQAATMPTALHSSASCDLTKQLLLQSLPQTGLQS

Chicken                       DLSAHRLSQPTALQASLPSQPSCELLPQQL---LPQATLQS

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 824 Neuronal PAS domain-containing protein 2



Literature citations
Molecular characterization of two mammalian bHLH-PAS domain proteins selectively expressed in the central nervous system.
Zhou Y.-D.; Barnard M.; Tian H.; Li X.; Ring H.Z.; Francke U.; Shelton J.; Richardson J.; Russell D.W.; McKnight S.L.;
Proc. Natl. Acad. Sci. U.S.A. 94:713-718(1997)
Cited for: NUCLEOTIDE SEQUENCE [MRNA]; VARIANTS ALA-394 AND LEU-471;
Circadian clock-related polymorphisms in seasonal affective disorder and their relevance to diurnal preference.
Johansson C.; Willeit M.; Smedh C.; Ekholm J.; Paunio T.; Kieseppa T.; Lichtermann D.; Praschak-Rieder N.; Neumeister A.; Nilsson L.G.; Kasper S.; Peltonen L.; Adolfsson R.; Schalling M.; Partonen T.;
Neuropsychopharmacology 28:734-739(2003)
Cited for: ASSOCIATION OF VARIANT LEU-471 WITH SAD;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.