Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q06643: Variant p.Ala122Asp

Lymphotoxin-beta
Gene: LTB
Feedback?
Variant information Variant position: help 122
Type of variant: help LB/B
Residue change: help From Alanine (A) to Aspartate (D) at position 122 (A122D, p.Ala122Asp).
Physico-chemical properties: help Change from small size and hydrophobic (A) to medium size and acidic (D)
BLOSUM score: help -2
Other resources: help


Sequence information Variant position: help 122
Protein sequence length: help 244
Location on the sequence: help LGWETTKEQAFLTSGTQFSD A EGLALPQDGLYYLYCLVGYR
Residue conservation: help
Human                         LGWETTKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYR

Rhesus macaque                LGWEATKEQAFLTSGTQFSDADGLALPQDGLYYLYCLVGYR

Chimpanzee                    LGWETTKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYR

Mouse                         LSWEASQEEAFLRSGAQFSPTHGLALPQDGVYYLYCHVGYR

Sequence annotation in neighborhood: help
TypePositionsDescription
Chain 1 – 244 Lymphotoxin-beta
Topological domain 49 – 244 Extracellular
Domain 88 – 243 THD
Alternative sequence 78 – 244 Missing. In isoform 2.
Mutagenesis 108 – 108 K -> E. In subunit 1; reduces binding of LTA(1)-LTB(2) to LTBR and abolishes LTBR-mediated NF-kappa-B signaling activation; when associated with R-109 and E-142, and 'A-142' in LTA. In subunit 2; reduces binding of LTA(1)-LTB(2) to LTBR and abolishes LTBR-mediated NF-kappa-B signaling activation; when associated with R-109 and E-142, and with 'A-170' in LTB (subunit 1). In subunit 1; abolishes binding of LTA(1)-LTB(2) to LTBR and abolishes LTBR-mediated NF-kappa-B signaling activation; when associated with R-109; E-142 and A-170, and with 'E-108'; 'R-109' and 'E-142' in LTB (subunit 2), and with 'A-142' in LTA.
Mutagenesis 109 – 109 E -> R. In subunit 1; reduces binding of LTA(1)-LTB(2) to LTBR and abolishes LTBR-mediated NF-kappa-B signaling activation; when associated with E-108 and E-142, and 'A-142' in LTA. In subunit 2; reduces binding of LTA(1)-LTB(2) to LTBR and abolishes LTBR-mediated NF-kappa-B signaling activation; when associated with E-108 and E-142, and with 'A-170' in LTB (subunit 1). In subunit 1; abolishes binding of LTA(1)-LTB(2) to LTBR and abolishes LTBR-mediated NF-kappa-B signaling activation; when associated with E-108; E-142 and A-170, and with 'E-108'; 'R-109' and 'E-142' in LTB (subunit 2), and with 'A-142' in LTA.
Mutagenesis 142 – 142 R -> E. In subunit 1; reduces binding of LTA(1)-LTB(2) to LTBR and abolishes LTBR-mediated NF-kappa-B signaling activation; when associated with E-108 and R-109, and 'A-142' in LTA. In subunit 2; reduces binding of LTA(1)-LTB(2) to LTBR and abolishes LTBR-mediated NF-kappa-B signaling activation; when associated with E-108 and R-109, and with 'A-170' in LTB (subunit 1). In subunit 1; abolishes binding of LTA(1)-LTB(2) to LTBR and abolishes LTBR-mediated NF-kappa-B signaling activation; when associated with E-108; R-109 and A-170, and with 'E-108'; 'R-109' and 'E-142' in LTB (subunit 2), and with 'A-142' in LTA.



Literature citations
No reference for the current variant in UniProtKB/Swiss-Prot.
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.