Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot O43272: Variant p.Ala455Ser

Proline dehydrogenase 1, mitochondrial
Gene: PRODH
Feedback?
Variant information Variant position: help 455 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help US The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Alanine (A) to Serine (S) at position 455 (A455S, p.Ala455Ser). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from small size and hydrophobic (A) to small size and polar (S) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In HYRPRO1; uncertain significance; mild decrease of enzymatic activity. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 455 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 600 The length of the canonical sequence.
Location on the sequence: help WCFGAKLVRGAYLAQERARA A EIGYEDPINPTYEATNAMYH The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         WCF--GAKLVRGAYLAQE-------RARAAEIGYEDPINPTYEATNAMYH

Mouse                         WCF--GAKLVRGAYMAQE-------RVRAAEIGYEDPINPT

Bovine                        WCF--GAKLVRGAYMAQ--------------VGYEDPINPT

Caenorhabditis elegans        WHF--GAKLVRGAYMEQE-------RARAKAIGYEDPINDN

Drosophila                    FYF--GAKLVRGAYMDQE-------RDRAKSLGYPDPVNPT

Slime mold                    FNFKLGAKIVRGAYMVTE-------SERSQRLSTENPVLPT

Fission yeast                 WLM--GAKLVRGAYLNSEPRFLIHDTKAETDKDFDSAVEAI



Literature citations
Functional consequences of PRODH missense mutations.
Bender H.-U.; Almashanu S.; Steel G.; Hu C.-A.; Lin W.-W.; Willis A.; Pulver A.; Valle D.;
Am. J. Hum. Genet. 76:409-420(2005)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); FUNCTION; CATALYTIC ACTIVITY; COFACTOR; VARIANT VAL-167; CHARACTERIZATION OF VARIANTS HYRPRO1 MET-289; ASN-426; MET-427; HIS-431; PRO-441; CYS-453; SER-455; THR-472 AND GLN-521; CHARACTERIZATION OF VARIANTS GLN-19; VAL-167; ARG-185; LEU-406 AND MET-466; PRODH mutations and hyperprolinemia in a subset of schizophrenic patients.
Jacquet H.; Raux G.; Thibaut F.; Hecketsweiler B.; Houy E.; Demilly C.; Haouzir S.; Allio G.; Fouldrin G.; Drouin V.; Bou J.; Petit M.; Campion D.; Frebourg T.;
Hum. Mol. Genet. 11:2243-2249(2002)
Cited for: VARIANTS HYRPRO1 MET-289; HIS-431; PRO-441; CYS-453; SER-455; THR-472 AND GLN-521; INVOLVEMENT IN HYRPRO1;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.