Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P35498: Variant p.Cys959Arg

Sodium channel protein type 1 subunit alpha
Gene: SCN1A
Feedback?
Variant information Variant position: help 959 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Cysteine (C) to Arginine (R) at position 959 (C959R, p.Cys959Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (C) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In DRVT; results in a non-functional channel. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 959 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 2009 The length of the canonical sequence.
Location on the sequence: help HSFLIVFRVLCGEWIETMWD C MEVAGQAMCLTVFMMVMVIG The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         HSFLIVFRVLCGEWIETMWDCMEVAGQAMCLTVFMMVMVIG

Mouse                         HSFLIVFRVLCGEWIETMWDCMEVAGQAMCLTVFMMVMVIG

Rat                           HSFLIVFRVLCGEWIETMWDCMEVAGQAMCLTVFMMVMVIR
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 2009 Sodium channel protein type 1 subunit alpha
Topological domain 958 – 970 Extracellular
Repeat 750 – 1022 II
Disulfide bond 959 – 968
Helix 954 – 963



Literature citations
De novo SCN1A mutations are a major cause of severe myoclonic epilepsy of infancy.
Claes L.; Ceulemans B.; Audenaert D.; Smets K.; Loefgren A.; Del-Favero J.; Ala-Mello S.; Basel-Vanagaite L.; Plecko B.; Raskin S.; Thiry P.; Wolf N.I.; Van Broeckhoven C.; De Jonghe P.;
Hum. Mutat. 21:615-621(2003)
Cited for: VARIANTS DRVT HIS-393; GLN-939; ARG-959; ARG-1434; SER-1661 AND GLU-1749; Nonfunctional SCN1A is common in severe myoclonic epilepsy of infancy.
Ohmori I.; Kahlig K.M.; Rhodes T.H.; Wang D.W.; George A.L. Jr.;
Epilepsia 47:1636-1642(2006)
Cited for: CHARACTERIZATION OF VARIANTS DRVT GLU-177; SER-227; HIS-393; ASN-426; GLN-939; ARG-959; PHE-1289 DEL AND ILE-1909;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.