UniProtKB/Swiss-Prot Q9NP58: Variant p.Arg648Gln

ATP-binding cassette sub-family B member 6
Gene: ABCB6
Feedback?

Variant information Variant position:

648 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Arginine (R) to Glutamine (Q) at position 648 (R648Q, p.Arg648Gln). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from large size and basic (R) to medium size and polar (Q) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Polymorphism:

Genetic variations in ABCB6 define the Langereis blood group system (LAN) [MIM:111600]. Individuals with Lan(-) blood group lack the Lan antigen on their red blood cells. These individuals may have anti-Lan antibodies in their serum, which can cause transfusion reactions or hemolytic disease of the fetus or newborn. The Lan(-) blood group is only clinically significant in transfusion settings or during pregnancy; otherwise Lan(-) individuals have no clinical features. Additional information on the polymorphism described.
Other resources:

Links to websites of interest for the variant.

Variant rs13402964 [ dbSNP | Ensembl ]

Sequence information Variant position:

648 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

842 The length of the canonical sequence.
Location on the sequence:

GKSTILRLLFRFYDISSGCI R IDGQDISQVTQASLRSHIGV The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         GKSTILRLLFRFYDISSGCIRIDGQDISQVTQASLRSHIGV

Mouse                         GKSTILRLLFRFYDISSGCIRIDGQDISQVTQISLRSHIGV

Rat                           GKSTILRLLFRFYDISSGCIRIDGQDISQVTQISLRSHIGV

Xenopus tropicalis            GKSTIIRLLFRFYDVKGGTIKVDGQDISTVRQESLRSHIGV

Slime mold                    GKSTIFRLLCRFYDVDQGEILINGENIKDVTQTSLRSIIGV

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 842	ATP-binding cassette sub-family B member 6
Topological domain	551 – 842	Cytoplasmic
Domain	590 – 824	ABC transporter
Mutagenesis	629 – 629	K -> A. Abolishes ATP hydrolysis. Abolishes coproporphyrin III transport.
Mutagenesis	629 – 629	K -> M. Does not affect subcellular location in early melanosome and lysosome. Does not rescue the normal amyloid fibril formation and normal maturation of pigmented melanosomes. Does not influence trafficking of melanosomal proteins. Fails to rescue vacuolar sequestration of cadmium in Schizosaccharomyces pombe and Caenorhabditis elegans strains defective for HMT-1. Fails to rescue the cadmium tolerance in Schizosaccharomyces pombe and Caenorhabditis elegans strains defective for HMT-1. Does not rescue vacuolar cadmium levels in hmt-1 mutant S.pombe.
Beta strand	643 – 649

Literature citations
No reference for the current variant in UniProtKB/Swiss-Prot.

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.