UniProtKB/Swiss-Prot Q99102: Variant p.Thr156Ala

Mucin-4
Gene: MUC4
Feedback?

Variant information Variant position:

156 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Threonine (T) to Alanine (A) at position 156 (T156A, p.Thr156Ala). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from medium size and polar (T) to small size and hydrophobic (A) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Polymorphism:

The variable number of tandem repeats (VNTR) region, an array of serine- and threonine-rich tandem repeats, is encoded by a single exon (exon 2) which is highly polymorphic. Additional information on the polymorphism described.
Other resources:

Links to websites of interest for the variant.

Variant rs2293232 [ dbSNP | Ensembl ]

Sequence information Variant position:

156 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

5412 The length of the canonical sequence.
Location on the sequence:

KTITMTTSTDSTLGNTEETS T AGTESSTPVTSAVSITAGQE The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         KTITMTTSTDSTLGNTEETSTAGTESSTPVTSAVSITAGQE

Mouse                         QASTSSTSSDRRTSKTEQTSTRDTPSS--------------

Rat                           QVSNPTASSYRMTKNTGQASPMVTSSS--------------

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	29 – 5412	Mucin-4
Chain	29 – 4687	Mucin-4 alpha chain
Region	43 – 4241	Variable number of tandem repeats (VNTR)
Region	142 – 249	Disordered
Glycosylation	154 – 154	O-linked (GalNAc...) threonine
Glycosylation	156 – 156	O-linked (GalNAc...) threonine
Alternative sequence	29 – 4315	Missing. In isoform 12.
Alternative sequence	29 – 4264	Missing. In isoform 13.

Literature citations
No reference for the current variant in UniProtKB/Swiss-Prot.

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.