UniProtKB/Swiss-Prot Q07889: Variant p.Gln977Arg

Son of sevenless homolog 1
Gene: SOS1
Feedback?

Variant information Variant position:

977 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Glutamine (Q) to Arginine (R) at position 977 (Q977R, p.Gln977Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from medium size and polar (Q) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs2124479522 [ dbSNP | Ensembl ]

Sequence information Variant position:

977 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

1333 The length of the canonical sequence.
Location on the sequence:

NFSKRRKVAEITGEIQQYQN Q PYCLRVESDIKRFFENLNPM The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         NFSKRRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPM

Mouse                         NFSKRRRVAEITGEIQQYQNQPYCLRVEPDIKRFFENLNPM

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 1333	Son of sevenless homolog 1
Domain	780 – 1019	Ras-GEF
Alternative sequence	372 – 1333	Missing. In isoform 2.

Literature citations
Gain-of-function SOS1 mutations cause a distinctive form of Noonan syndrome.
Tartaglia M.; Pennacchio L.A.; Zhao C.; Yadav K.K.; Fodale V.; Sarkozy A.; Pandit B.; Oishi K.; Martinelli S.; Schackwitz W.; Ustaszewska A.; Martin J.; Bristow J.; Carta C.; Lepri F.; Neri C.; Vasta I.; Gibson K.; Curry C.J.; Lopez Siguero J.P.; Digilio M.C.; Zampino G.; Dallapiccola B.; Bar-Sagi D.; Gelb B.D.;
Nat. Genet. 39:75-79(2007)
Cited for: VARIANTS NS4 LYS-108; ARG-269; ARG-432; LYS-433; TYR-441; ARG-548; PRO-550; GLY-552; LYS-552; SER-552; HIS-702; LEU-729; PHE-733 AND LYS-846; VARIANTS LEU-655; ARG-977 AND ARG-1320; CHARACTERIZATION OF VARIANTS NS4 GLY-552 AND LEU-729;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.