UniProtKB/Swiss-Prot Q92614: Variant p.Ala958Val

Unconventional myosin-XVIIIa
Gene: MYO18A
Feedback?

Variant information Variant position:

958 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Alanine (A) to Valine (V) at position 958 (A958V, p.Ala958Val). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from small size and hydrophobic (A) to medium size and hydrophobic (V) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs8076604 [ dbSNP | Ensembl ]

Sequence information Variant position:

958 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

2054 The length of the canonical sequence.
Location on the sequence:

VEYNVTGWLNYTKQNPATQN A PRLLQDSQKKIISNLFLGRA The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         VEYNVTGWLNYTKQNPATQNAPRLLQDSQKKIISNLFLGRA

Mouse                         VEYNVAGWLNYTKQNPATQNAPRLLQDSQKKIISNLFLGRA

Rat                           VEYNVTGWLNYTKQNPATQNAPRLLQDSQNSVVECLPSKRK

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 2054	Unconventional myosin-XVIIIa
Domain	405 – 1185	Myosin motor

Literature citations
Identification of the surfactant protein A receptor 210 as the unconventional myosin 18A.
Yang C.H.; Szeliga J.; Jordan J.; Faske S.; Sever-Chroneos Z.; Dorsett B.; Christian R.E.; Settlage R.E.; Shabanowitz J.; Hunt D.F.; Whitsett J.A.; Chroneos Z.C.;
J. Biol. Chem. 280:34447-34457(2005)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5); IDENTIFICATION BY MASS SPECTROMETRY; FUNCTION; SUBCELLULAR LOCATION; VARIANT VAL-958; Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.
Nagase T.; Seki N.; Ishikawa K.; Ohira M.; Kawarabayasi Y.; Ohara O.; Tanaka A.; Kotani H.; Miyajima N.; Nomura N.;
DNA Res. 3:321-329(1996)
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1); VARIANT VAL-958; The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
The MGC Project Team;
Genome Res. 14:2121-2127(2004)
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3); VARIANT VAL-958;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.