Home  |  Contact

UniProtKB/Swiss-Prot P01138: Variant p.Arg221Trp

Beta-nerve growth factor
Gene: NGF
Variant information

Variant position:  221
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Arginine (R) to Tryptophan (W) at position 221 (R221W, p.Arg221Trp).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and basic (R) to large size and aromatic (W)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Neuropathy, hereditary sensory and autonomic, 5 (HSAN5) [MIM:608654]: A form of hereditary sensory and autonomic neuropathy, a genetically and clinically heterogeneous group of disorders characterized by degeneration of dorsal root and autonomic ganglion cells, and by sensory and/or autonomic abnormalities. HSAN5 patients manifest loss of pain perception and impaired temperature sensitivity, ulcers, and in some cases self-mutilation. The autonomic involvement is variable. {ECO:0000269|PubMed:14976160, ECO:0000269|PubMed:20978020, ECO:0000269|PubMed:22302274}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In HSAN5; impaired processing of the precursor to mature NGF; nearly abolishes secretion; loss of function in stimulating cell differentiation; loss of the ability to activate the NTRK1 receptor.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  221
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  241
The length of the canonical sequence.

Location on the sequence:   CTTTHTFVKALTMDGKQAAW  R FIRIDTACVCVLSRKAVRRA
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         CTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

Gorilla                       CTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

Chimpanzee                    CTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

Mouse                         CTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG

Rat                           CTTTHTFVKALTTDDKQAAWRFIRIDTACVCVLSRKAARRG

Bovine                        CTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKTGQRA

Chicken                       CTTTHTFVKALTMEGKQAAWRFIRIDTACVCVLSRKSGRP-

Xenopus laevis                CTTTHTFVKALTMEGKQAAWRFIRIDTACVCVLSRK-GRT-

Zebrafish                     CTNSHTFVRALTSFKNLVAWRLIRINVACVCVLSRKSWRA-

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 122 – 241 Beta-nerve growth factor
Binding site 209 – 209 Phosphatidylinositide
Disulfide bond 179 – 229
Disulfide bond 189 – 231
Beta strand 215 – 235


Literature citations

A mutation in the nerve growth factor beta gene (NGFB) causes loss of pain perception.
Einarsdottir E.; Carlsson A.; Minde J.; Toolanen G.; Svensson O.; Solders G.; Holmgren G.; Holmberg D.; Holmberg M.;
Hum. Mol. Genet. 13:799-805(2004)
Cited for: VARIANT HSAN5 TRP-221; FUNCTION;

A novel NGF mutation clarifies the molecular mechanism and extends the phenotypic spectrum of the HSAN5 neuropathy.
Carvalho O.P.; Thornton G.K.; Hertecant J.; Houlden H.; Nicholas A.K.; Cox J.J.; Rielly M.; Al-Gazali L.; Woods C.G.;
J. Med. Genet. 48:131-135(2011)
Cited for: CHARACTERIZATION OF VARIANT HSAN5 TRP-221; FUNCTION; SUBCELLULAR LOCATION;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.