Home  |  Contact

UniProtKB/Swiss-Prot Q6IB77: Variant p.Asn156Ser

Glycine N-acyltransferase
Gene: GLYAT
Variant information

Variant position:  156
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  LB/B
The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change:  From Asparagine (N) to Serine (S) at position 156 (N156S, p.Asn156Ser).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and polar (N) to small size and polar (S)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  156
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  296
The length of the canonical sequence.

Location on the sequence:   AAETAKELTPFLLKSKILSP  N GGKPKAINQEMFKLSSMDVT
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         AAETAKELTPFLLKSKILSPNGGKPKAINQEMFKLSSMDVT

Mouse                         SSETIKKLFPSLLDTKNLSTGSGKPKAIDQDKFKLSSLDVV

Rat                           VSETVRKLFPSLLDTKNLSPGSGKPKAINQEMFKLSSLDVT

Bovine                        ASETIKELTPSLLDVKNLPVGDGKPKAIDPEMFKLSSVDPS

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 296 Glycine N-acyltransferase
Modified residue 141 – 141 N6-acetyllysine; alternate
Modified residue 141 – 141 N6-succinyllysine; alternate
Modified residue 159 – 159 N6-acetyllysine
Modified residue 169 – 169 N6-succinyllysine
Alternative sequence 163 – 163 I -> M. In isoform 2.


Literature citations

The utilization of alanine, glutamic acid, and serine as amino acid substrates for glycine N-acyltransferase.
van der Westhuizen F.H.; Pretorius P.J.; Erasmus E.;
J. Biochem. Mol. Toxicol. 14:102-109(2000)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2); VARIANT SER-156;

Designation of enzyme activity of glycine-N-acyltransferase family genes and depression of glycine-N-acyltransferase in human hepatocellular carcinoma.
Matsuo M.; Terai K.; Kameda N.; Matsumoto A.; Kurokawa Y.; Funase Y.; Nishikawa K.; Sugaya N.; Hiruta N.; Kishimoto T.;
Biochem. Biophys. Res. Commun. 420:901-906(2012)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); FUNCTION; CATALYTIC ACTIVITY; SUBCELLULAR LOCATION; TISSUE SPECIFICITY; VARIANT SER-156;

Human HRP-1(CLP).
Kishimoto T.; Niwa S.; Nishikawa K.;
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); VARIANT SER-156;

The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
The MGC Project Team;
Genome Res. 14:2121-2127(2004)
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2); VARIANTS THR-17 AND SER-156;

Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201).
Ebert L.; Schick M.; Neubert P.; Schatten R.; Henze S.; Korn B.;
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 2-163; VARIANT SER-156;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.