Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q14654: Variant p.Phe55Leu

ATP-sensitive inward rectifier potassium channel 11
Gene: KCNJ11
Feedback?
Variant information Variant position: help 55 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Phenylalanine (F) to Leucine (L) at position 55 (F55L, p.Phe55Leu). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and aromatic (F) to medium size and hydrophobic (L) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In HHF2; does neither affect channel expression nor channel response to MgADP. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 55 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 390 The length of the canonical sequence.
Location on the sequence: help FVSKKGNCNVAHKNIREQGR F LQDVFTTLVDLKWPHTLLIF The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         FVSKKGNCNVAHKNIREQGRFLQDVFTTLVDLKWPHTLLIF

Mouse                         FVSKKGNCNVAHKNIREQGRFLQDVFTTLVDLKWPHTLLIF

Rat                           FVSKKGNCNVAHKNIREQGRFLQDVFTTLVDLKWPHTLLIF

Rabbit                        FVSKKGNCNVAHKNIREQGRFLQDVFTTLVDLKWTHTLLIF
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 390 ATP-sensitive inward rectifier potassium channel 11
Topological domain 1 – 68 Cytoplasmic
Alternative sequence 1 – 87 Missing. In isoform 2.
Mutagenesis 64 – 64 V -> M. Displays gain of function; increased open state stability, reduced ATP sensitivity and increased channel activity; almost completely abolishes high affinity sensitivity to glibenclamide, an inhibitor of ATP-sensitive potassium channels.
Helix 52 – 56



Literature citations
Clinical characteristics and biochemical mechanisms of congenital hyperinsulinism associated with dominant KATP channel mutations.
Pinney S.E.; MacMullen C.; Becker S.; Lin Y.W.; Hanna C.; Thornton P.; Ganguly A.; Shyng S.L.; Stanley C.A.;
J. Clin. Invest. 118:2877-2886(2008)
Cited for: INVOLVEMENT IN HHF2; VARIANTS HHF2 LEU-55; ARG-156 AND GLU-204; A novel KCNJ11 mutation associated with congenital hyperinsulinism reduces the intrinsic open probability of beta-cell ATP-sensitive potassium channels.
Lin Y.-W.; MacMullen C.; Ganguly A.; Stanley C.A.; Shyng S.-L.;
J. Biol. Chem. 281:3006-3012(2006)
Cited for: VARIANT HHF2 LEU-55; CHARACTERIZATION OF VARIANT HHF2 LEU-55;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.