Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot O95475: Variant p.His141Asn

Homeobox protein SIX6
Gene: SIX6
Feedback?
Variant information Variant position: help 141 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Histidine (H) to Asparagine (N) at position 141 (H141N, p.His141Asn). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and polar. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 141 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 246 The length of the canonical sequence.
Location on the sequence: help LPRTIWDGEQKTHCFKERTR H LLREWYLQDPYPNPSKKREL The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         LPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKREL

Mouse                         LPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKREL

Chicken                       LPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKREL

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 246 Homeobox protein SIX6
DNA binding 128 – 187 Homeobox



Literature citations
OPTX2, a novel gene expressed in the eye, belongs to a cluster of sine oculis-related homeobox genes.
Leppert G.S.; Yang J.-M.; Toy J.; Sundin O.H.;
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANT ASN-141; Six9 (Optx2), a new member of the Six gene family of transcription factors, is expressed at early stages of vertebrate ocular and pituitary development.
Lopez-Rios J.; Gallardo E.; Rodriguez de Cordoba S.; Bovolenta P.;
Mech. Dev. 83:155-159(1999)
Cited for: NUCLEOTIDE SEQUENCE [MRNA]; VARIANT ASN-141; Genomic cloning and characterization of the human homeobox gene SIX6 reveals a cluster of SIX genes in chromosome 14 and associates SIX6 hemizygosity with bilateral anophthalmia and pituitary anomalies.
Gallardo M.E.; Lopez-Rios J.; Fernaud-Espinosa I.; Granadino B.; Sanz R.; Ramos C.; Ayuso C.; Seller M.J.; Brunner H.G.; Bovolenta P.; Rodriguez de Cordoba S.;
Genomics 61:82-91(1999)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANT ASN-141; The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
The MGC Project Team;
Genome Res. 14:2121-2127(2004)
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]; VARIANT ASN-141; Analysis of the developmental SIX6 homeobox gene in patients with anophthalmia/microphthalmia.
Gallardo M.E.; Rodriguez De Cordoba S.; Schneider A.S.; Dwyer M.A.; Ayuso C.; Bovolenta P.;
Am. J. Med. Genet. A 129:92-94(2004)
Cited for: VARIANTS ASN-141 AND ALA-165;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.