UniProtKB/Swiss-Prot Q14980: Variant p.Tyr1836His

Nuclear mitotic apparatus protein 1
Gene: NUMA1
Feedback?

Variant information Variant position:

1836 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Tyrosine (Y) to Histidine (H) at position 1836 (Y1836H, p.Tyr1836His). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from large size and aromatic (Y) to medium size and polar (H) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs35586429 [ dbSNP | Ensembl ]

Sequence information Variant position:

1836 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

2115 The length of the canonical sequence.
Location on the sequence:

NITMTKKLDVEEPDSANSSF Y STRSAPASQASLRATSSTQS The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         NITMTKKLDVEEPDSANSSFYSTRSAPASQASLRATSSTQS

Mouse                         NITMTKKLELEEPDSANSSFYSTQSAPASQANLRATSSTQS

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 2115	Nuclear mitotic apparatus protein 1
Region	1699 – 1876	Membrane-binding domain 1
Region	1700 – 2115	Tail (Globular)
Region	1826 – 1901	Disordered
Compositional bias	1830 – 1862	Polar residues
Modified residue	1830 – 1830	Phosphoserine
Modified residue	1833 – 1833	Phosphoserine
Modified residue	1834 – 1834	Phosphoserine; by PLK1
Modified residue	1836 – 1836	Phosphotyrosine
Modified residue	1840 – 1840	Phosphoserine
Modified residue	1844 – 1844	Phosphoserine; alternate
Glycosylation	1844 – 1844	O-linked (GlcNAc) serine; alternate
Cross	1822 – 1822	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)
Alternative sequence	1725 – 2115	LDLSCEEGTPLSITSKLPRTQPDGTSVPGEPASPISQRLPPKVESLESLYFTPIPARSQAPLESSLDSLGDVFLDSGRKTRSARRRTTQIINITMTKKLDVEEPDSANSSFYSTRSAPASQASLRATSSTQSLARLGSPDYGNSALLSLPGYRPTTRSSARRSQAGVSSGAPPGRNSFYMGTCQDEPEQLDDWNRIAELQQRNRVCPPHLKTCYPLESRPSLSLGTITDEEMKTGDPQETLRRASMQPIQIAEGTGITTRQQRKRVSLEPHQGPGTPESKKATSCFPRPMTPRDRHEGRKQSTTEAQKKAAPASTKQADRRQSMAFSILNTPKKLGNSLLRRGASKKALSKASPNTRSGTRRSPRIATTTASAATAAAIGATPRAKGKAKH -> SQANSSQTPRDSDACPHPGLVPGPSLAPSRSWPRGPGAWTVWALSLPCLLFS. In isoform 3.
Alternative sequence	1739 – 2115	SKLPRTQPDGTSVPGEPASPISQRLPPKVESLESLYFTPIPARSQAPLESSLDSLGDVFLDSGRKTRSARRRTTQIINITMTKKLDVEEPDSANSSFYSTRSAPASQASLRATSSTQSLARLGSPDYGNSALLSLPGYRPTTRSSARRSQAGVSSGAPPGRNSFYMGTCQDEPEQLDDWNRIAELQQRNRVCPPHLKTCYPLESRPSLSLGTITDEEMKTGDPQETLRRASMQPIQIAEGTGITTRQQRKRVSLEPHQGPGTPESKKATSCFPRPMTPRDRHEGRKQSTTEAQKKAAPASTKQADRRQSMAFSILNTPKKLGNSLLRRGASKKALSKASPNTRSGTRRSPRIATTTASAATAAAIGATPRAKGKAKH -> RSGGSLPPYVCLWSACCLSGCILVR. In isoform 4.

Literature citations
No reference for the current variant in UniProtKB/Swiss-Prot.

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.