Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot O00423: Variant p.Ser556Pro

Echinoderm microtubule-associated protein-like 1
Gene: EML1
Feedback?
Variant information Variant position: help 556 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Serine (S) to Proline (P) at position 556 (S556P, p.Ser556Pro). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from small size and polar (S) to medium size and hydrophobic (P) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 556 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 815 The length of the canonical sequence.
Location on the sequence: help TPITQGHTDELWGLAIHASK S QFLTCGHDKHATLWDAVGHR The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         TPITQGHTDELWGLAIHASKSQFLTCGHDKHATLWDAVGHR

Mouse                         TPITQGHTDELWGLAIHASKPQFLTCGHDKHATLWDAVGHR

Rat                           TPITQGHTDELWGLAIHASKPQFLTCGHDKHATLWDAVGHR

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 815 Echinoderm microtubule-associated protein-like 1
Repeat 535 – 572 WD 7
Region 176 – 815 Tandem atypical propeller in EMLs
Mutagenesis 547 – 547 W -> A. Abolishes tubulin binding; when associated with S-192; S-194; T-626; S-627; A-646 and A-786.
Beta strand 553 – 562



Literature citations
Isolation of a novel human homologue of the gene coding for echinoderm microtubule-associated protein (EMAP) from the Usher syndrome type 1a locus at 14q32.
Eudy J.D.; Ma-Edmonds M.; Yao S.F.; Talmadge C.B.; Kelley P.M.; Weston M.D.; Kimberling W.J.; Sumegi J.;
Genomics 43:104-106(1997)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); VARIANT PRO-556; Complete exon-intron structure of human homologue of the gene coding the echinoderm microtubule-associated protein (EMAP).
Gerber S.; Sumegi J.; Rozet J.-M.; Perrault I.; Ducroq D.; Munnich A.; Kaplan J.;
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANT PRO-556; The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
The MGC Project Team;
Genome Res. 14:2121-2127(2004)
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1); VARIANTS ASN-552 AND PRO-556;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.