Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q12768: Variant p.Asn471Asp

WASH complex subunit 5
Gene: WASHC5
Feedback?
Variant information Variant position: help 471 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Asparagine (N) to Aspartate (D) at position 471 (N471D, p.Asn471Asp). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (N) to medium size and acidic (D) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In SPG8; does not alter subcellular distribution; no effect on its binding to VCP; no effect on assembly in the WASH complex. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 471 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1159 The length of the canonical sequence.
Location on the sequence: help TELADVFSGVKPLTRVEKNE N LQAWFREISKQILSLNYDDS The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         TELADVFSGVKPLTRVEKNENLQAWFREISKQILSLNYDDS

Mouse                         TELADVFSGVKPLTRVEKNENLQAWFREISKQILSLNYDDS

Xenopus tropicalis            TELADVFSGVKPLTRVEKNEHLQAWFREIAKQIHSLNYDDS

Zebrafish                     MELAEVFSGVKPLTRVEKNENLQAWFREISKQIESLNYEDS

Drosophila                    NELSEAFAGSRPLSKIEQNPQLQQWFGEVAGRLQKLELSRP

Slime mold                    VELSEYFSGEKALTRVKKNENLQKWFGEISQKISQLDSTDS
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 1159 WASH complex subunit 5



Literature citations
Strumpellin is a novel valosin-containing protein binding partner linking hereditary spastic paraplegia to protein aggregation diseases.
Clemen C.S.; Tangavelou K.; Strucksberg K.H.; Just S.; Gaertner L.; Regus-Leidig H.; Stumpf M.; Reimann J.; Coras R.; Morgan R.O.; Fernandez M.P.; Hofmann A.; Muller S.; Schoser B.; Hanisch F.G.; Rottbauer W.; Blumcke I.; von Horsten S.; Eichinger L.; Schroder R.;
Brain 133:2920-2941(2010)
Cited for: SUBCELLULAR LOCATION; TISSUE SPECIFICITY; INTERACTION WITH VCP; FUNCTION; CHARACTERIZATION OF VARIANT SPG8 ASP-471; The hereditary spastic paraplegia protein strumpellin: characterisation in neurons and of the effect of disease mutations on WASH complex assembly and function.
Freeman C.; Seaman M.N.; Reid E.;
Biochim. Biophys. Acta 1832:160-173(2013)
Cited for: FUNCTION; SUBCELLULAR LOCATION; CHARACTERIZATION OF VARIANTS SPG8 ASP-471; PHE-619 AND PHE-626; Mutations in the KIAA0196 gene at the SPG8 locus cause hereditary spastic paraplegia.
Valdmanis P.N.; Meijer I.A.; Reynolds A.; Lei A.; MacLeod P.; Schlesinger D.; Zatz M.; Reid E.; Dion P.A.; Drapeau P.; Rouleau G.A.;
Am. J. Hum. Genet. 80:152-161(2007)
Cited for: VARIANTS SPG8 ASP-471; PHE-619 AND PHE-626; CHARACTERIZATION OF VARIANTS SPG8 PHE-619 AND PHE-626;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.