Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9H3D4: Variant p.Asp351His

Tumor protein 63
Gene: TP63
Feedback?
Variant information Variant position: help 351 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Aspartate (D) to Histidine (H) at position 351 (D351H, p.Asp351His). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and acidic (D) to medium size and polar (H) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In EEC3. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 351 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 680 The length of the canonical sequence.
Location on the sequence: help DGQVLGRRCFEARICACPGR D RKADEDSIRKQQVSDSTKNG The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         DGQVLGRRCFEARICACPGRDRKADEDSIRKQQVSDSTKNG

Mouse                         DGQVLGRRCFEARICACPGRDRKADEDSIRKQQVSDSAKNG

Rat                           DGQVLGRRCFEARICACPGRDRKADEDSIRKQQVSDSAKNG
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 680 Tumor protein 63
DNA binding 170 – 362
Region 351 – 393 Disordered
Compositional bias 351 – 360 Basic and acidic residues
Helix 348 – 357



Literature citations
p63 gene mutations in EEC syndrome, limb-mammary syndrome, and isolated split hand-split foot malformation suggest a genotype-phenotype correlation.
van Bokhoven H.; Hamel B.C.J.; Bamshad M.; Sangiorgi E.; Gurrieri F.; Duijf P.H.G.; Vanmolkot K.R.J.; van Beusekom E.; van Beersum S.E.C.; Celli J.; Merkx G.F.M.; Tenconi R.; Fryns J.-P.; Verloes A.; Newbury-Ecob R.A.; Raas-Rotschild A.; Majewski F.; Beemer F.A.; Janecke A.; Chitayat D.; Crisponi G.; Kayserili H.; Yates J.R.W.; Neri G.; Brunner H.G.;
Am. J. Hum. Genet. 69:481-492(2001)
Cited for: VARIANTS EEC3 GLN-243; TRP-243; GLN-266; TYR-308; ASN-311; CYS-318; HIS-318; GLN-318; CYS-319; HIS-319; SER-319; TRP-343; GLN-343; ARG-345; SER-347; SER-348 AND HIS-351; VARIANTS SHFM4 PRO-193 INS; GLU-232 AND HIS-319; INVOLVEMENT IN LMS;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.