UniProtKB/SwissProt variant VAR

Activated CDC42 kinase 1
Gene: TNK2
Feedback?

Variant information Variant position:

152
Type of variant:

LB/B
Residue change:

From Threonine (T) to Methionine (M) at position 152 (T152M, p.Thr152Met).
Physico-chemical properties:

Change from medium size and polar (T) to medium size and hydrophobic (M)
BLOSUM score:

-1
Other resources:

Variant rs56161912 [ dbSNP | Ensembl ]

Sequence information Variant position:

152
Protein sequence length:

1038
Location on the sequence:

LGDGSFGVVRRGEWDAPSGK T VSVAVKCLKPDVLSQPEAMD
Residue conservation:

Human                         LGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMD

Mouse                         LGDGSFGVVRRGEWDAPAGKTVSVAVKCLKPDVLSQPEAMD

Rat                           LGDGSFGVVRRGEWDAPAGKTVSVAVKCLKPDVLSQPEAMD

Bovine                        LGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMD

Baker's yeast                 LGNANSD--RHGL---PA------------QNIVPAPYPVD

Sequence annotation in neighborhood:

Type	Positions	Description
Chain	1 – 1038	Activated CDC42 kinase 1
Domain	126 – 385	Protein kinase
Binding site	158 – 158
Mutagenesis	158 – 158	K -> R. Loss of autophosphorylation at Y-284.
Beta strand	152 – 159

Literature citations
Patterns of somatic mutation in human cancer genomes.
Greenman C.; Stephens P.; Smith R.; Dalgliesh G.L.; Hunter C.; Bignell G.; Davies H.; Teague J.; Butler A.; Stevens C.; Edkins S.; O'Meara S.; Vastrik I.; Schmidt E.E.; Avis T.; Barthorpe S.; Bhamra G.; Buck G.; Choudhury B.; Clements J.; Cole J.; Dicks E.; Forbes S.; Gray K.; Halliday K.; Harrison R.; Hills K.; Hinton J.; Jenkinson A.; Jones D.; Menzies A.; Mironenko T.; Perry J.; Raine K.; Richardson D.; Shepherd R.; Small A.; Tofts C.; Varian J.; Webb T.; West S.; Widaa S.; Yates A.; Cahill D.P.; Louis D.N.; Goldstraw P.; Nicholson A.G.; Brasseur F.; Looijenga L.; Weber B.L.; Chiew Y.-E.; DeFazio A.; Greaves M.F.; Green A.R.; Campbell P.; Birney E.; Easton D.F.; Chenevix-Trench G.; Tan M.-H.; Khoo S.K.; Teh B.T.; Yuen S.T.; Leung S.Y.; Wooster R.; Futreal P.A.; Stratton M.R.;
Nature 446:153-158(2007)
Cited for: VARIANTS LEU-34; ARG-71; GLN-99; TRP-99; MET-152; LYS-346; ILE-409; SER-507; LEU-725; GLN-748 AND HIS-1038;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q07912: Variant p.Thr152Met