Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P41229: Variant p.Tyr751Cys

Lysine-specific demethylase 5C
Gene: KDM5C
Feedback?
Variant information Variant position: help 751 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Tyrosine (Y) to Cysteine (C) at position 751 (Y751C, p.Tyr751Cys). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and aromatic (Y) to medium size and polar (C) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In MRXSCJ; impairs enzymatic activity. Any additional useful information about the variant.


Sequence information Variant position: help 751 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1560 The length of the canonical sequence.
Location on the sequence: help LSHINDLCKCSSSRQYLRYR Y TLDELPAMLHKLKVRAESFD The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         LSHINDLCKCSSSRQYLRYRYTLDELPAMLHKLKVRAESFD

                              LSHINDLCKCSSSRQYLRYRYTLDELPAMLHKLKVRAESFD

Mouse                         LSHINDLCKCSSSRQYLRYRYTLDELPAMLHKLKVRAESFD

Pig                           LSHINDLCKCSSSRQYLRYRYTLDELPAMLHKLKVRAESFD
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 1560 Lysine-specific demethylase 5C
Zinc finger 707 – 759 C5HC2
Beta strand 745 – 751



Literature citations
The X-linked mental retardation gene SMCX/JARID1C defines a family of histone H3 lysine 4 demethylases.
Iwase S.; Lan F.; Bayliss P.; de la Torre-Ubieta L.; Huarte M.; Qi H.H.; Whetstine J.R.; Bonni A.; Roberts T.M.; Shi Y.;
Cell 128:1077-1088(2007)
Cited for: FUNCTION; MUTAGENESIS OF HIS-514; CHARACTERIZATION OF VARIANTS MRXSCJ PRO-388; LEU-642; PHE-731 AND CYS-751; The histone H3K4 demethylase SMCX links REST target genes to X-linked mental retardation.
Tahiliani M.; Mei P.; Fang R.; Leonor T.; Rutenberg M.; Shimizu F.; Li J.; Rao A.; Shi Y.;
Nature 447:601-605(2007)
Cited for: FUNCTION; SUBUNIT; MUTAGENESIS OF HIS-514; SUBCELLULAR LOCATION; CHARACTERIZATION OF VARIANTS MRXSCJ GLY-87; TYR-402 AND CYS-751; Novel JARID1C/SMCX mutations in patients with X-linked mental retardation.
Tzschach A.; Lenzner S.; Moser B.; Reinhardt R.; Chelly J.; Fryns J.-P.; Kleefstra T.; Raynaud M.; Turner G.; Ropers H.-H.; Kuss A.; Jensen L.R.;
Hum. Mutat. 27:389-389(2006)
Cited for: VARIANTS MRXSCJ GLY-87; LEU-642; TRP-750 AND CYS-751;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.