Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P17861: Variant p.Arg232Lys

X-box-binding protein 1
Gene: XBP1
Feedback?
Variant information Variant position: help 232 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help US The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Arginine (R) to Lysine (K) at position 232 (R232K, p.Arg232Lys). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are large size and basic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In a breast cancer sample; somatic mutation. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 232 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 261 The length of the canonical sequence.
Location on the sequence: help TQSCSSNALPQSLPAWRSSQ R STQKDPVPYQPPFLCQWGRH The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         TQSC--------------SSNALPQSLPAW----------------------------------------------RSSQRSTQ-----------KDPVPYQPPFLCQ------------------------------WGRH

Mouse                         TLSC--------------FSNVLPQSLLVW-----------

Rat                           TLSC--------------FSNVLPQSLLIW-----------

Bovine                        TQSC--------------SSDVLPQSLPAW-----------

Caenorhabditis elegans        SILC--------------NHMDRNKKMDTS-----------

Baker's yeast                 RLLCLRFCFPIRYFLVPIFGPDFPKDCESWYLAHQNVTFAS

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 261 X-box-binding protein 1
Chain 196 – 261 X-box-binding protein 1, luminal form
Topological domain 204 – 261 Lumenal
Alternative sequence 167 – 261 LRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWGRHQPSWKPLMN -> GAGPVVTPPEHLPMDSGGIDSSDSESDILLGILDNLDPVMFFKCPSPEPASLEELPEVYPEGPSSLPASLSLSVGTSSAKLEAINELIRFDHIYTKPLVLEIPSETESQANVVVKIEEAPLSPSENDHPEFIVSVKEEPVEDDLVPELGISNLLSSSHCPKPSSCLLDAYSDCGYGGSLSPFSDMSSLLGVNHSWEDTFANELFPQLISV. In isoform 2.
Mutagenesis 212 – 212 T -> N. Does not induce glycosylation.
Mutagenesis 215 – 215 C -> N. Induces glycosylation.
Mutagenesis 232 – 232 R -> N. Induces glycosylation.
Mutagenesis 246 – 246 L -> A. Reduces translational pausing, membrane targeting and cytoplasmic splicing of its own mRNA.



Literature citations
Somatic sequence alterations in twenty-one genes selected by expression profile analysis of breast carcinomas.
Chanock S.J.; Burdett L.; Yeager M.; Llaca V.; Langeroed A.; Presswalla S.; Kaaresen R.; Strausberg R.L.; Gerhard D.S.; Kristensen V.; Perou C.M.; Boerresen-Dale A.-L.;
Breast Cancer Res. 9:R5-R5(2007)
Cited for: VARIANT LYS-232;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.