Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q12840: Variant p.Tyr276Cys

Kinesin heavy chain isoform 5A
Gene: KIF5A
Feedback?
Variant information Variant position: help 276 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Tyrosine (Y) to Cysteine (C) at position 276 (Y276C, p.Tyr276Cys). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and aromatic (Y) to medium size and polar (C) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In SPG10. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 276 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1032 The length of the canonical sequence.
Location on the sequence: help NKSLSALGNVISALAEGTKS Y VPYRDSKMTRILQDSLGGNC The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         NKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNC

Mouse                         NKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNC

Rat                           NKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNC
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 2 – 1032 Kinesin heavy chain isoform 5A
Domain 9 – 327 Kinesin motor
Region 174 – 315 Microtubule-binding
Region 271 – 361 Necessary for interaction with ZFYVE27
Mutagenesis 280 – 280 R -> S. Strongly reduces microtubule affinity; slightly reduces gliding velocity.



Literature citations
Mutation in KIF5A can also cause adult-onset hereditary spastic paraplegia.
Blair M.A.; Ma S.; Hedera P.;
Neurogenetics 7:47-50(2006)
Cited for: VARIANT SPG10 CYS-276;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.