UniProtKB/Swiss-Prot Q15831: Variant p.Pro315Ser

Serine/threonine-protein kinase STK11
Gene: STK11
Feedback?

Variant information Variant position:

315 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

US The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Proline (P) to Serine (S) at position 315 (P315S, p.Pro315Ser). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from medium size and hydrophobic (P) to small size and polar (S) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Variant description:

In PJS; uncertain significance; no effect heterotrimeric complex assembly with STRADA and CAB39. Any additional useful information about the variant.
Other resources:

Links to websites of interest for the variant.

Variant rs786202431 [ dbSNP | Ensembl ]

Sequence information Variant position:

315 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

433 The length of the canonical sequence.
Location on the sequence:

AKRFSIRQIRQHSWFRKKHP P AEAPVPIPPSPDTKDRWRSM The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         AKRFSIRQIRQHSWFRKKHPPAEAPVPI------------------------------------------------------------PPSP---------------DTKDRWRSM

Mouse                         AKRFSIRQIRQHSWFRKKHPLAEALVPI-------------

Rat                           AKRFSIRQIRQHSWFRKKHPLAEALVPI-------------

Chicken                       AKRFSIQQIRQHNWFRKKHAQAETLVPI-------------

Xenopus laevis                AKRFSIQQIRQHNWFRKKHPHMDPIVPI-------------

Slime mold                    IQRFSLGQIKNHPWCIKYIPEVEPFVPLLEESKFLPLEMAY

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 430	Serine/threonine-protein kinase STK11
Region	312 – 331	Disordered
Modified residue	296 – 296	N6-acetyllysine
Modified residue	311 – 311	N6-acetyllysine
Modified residue	325 – 325	Phosphoserine

Literature citations
Structure of the LKB1-STRAD-MO25 complex reveals an allosteric mechanism of kinase activation.
Zeqiraj E.; Filippi B.M.; Deak M.; Alessi D.R.; van Aalten D.M.;
Science 326:1707-1711(2009)
Cited for: X-RAY CRYSTALLOGRAPHY (2.65 ANGSTROMS) OF 43-347 IN COMPLEX WITH STRADA AND CAB39; ACTIVITY REGULATION; CHARACTERIZATION OF VARIANTS SPORADIC CANCER MET-66; GLY-86; ARG-123; SER-157; ASP-163; PRO-170; SER-171; ARG-174; TYR-176; ASN-177; GLU-181; GLN-199; THR-205; PHE-216; VAL-223; PRO-230; PRO-232; ARG-245; PRO-250; HIS-272; TYR-277; GLN-285 AND SER-315; MUTAGENESIS OF ARG-74; ASP-194 AND PHE-204; Mutation analysis of the STK11/LKB1 gene and clinical characteristics of an Australian series of Peutz-Jeghers syndrome patients.
Scott R.J.; Crooks R.; Meldrum C.J.; Thomas L.; Smith C.J.A.; Mowat D.; McPhillips M.; Spigelman A.D.;
Clin. Genet. 62:282-287(2002)
Cited for: VARIANTS PJS CYS-239 AND SER-315;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.